PDB entry 2ob5

View 2ob5 on RCSB PDB site
Description: Crystal structure of protein Atu2016, putative sugar binding protein
Class: sugar binding protein
Keywords: Agrobacterium tumefaciens, putavite sugar binding protein, Structural Genomics, PSI-2, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, SUGAR BINDING PROTEIN
Deposited on 2006-12-18, released 2007-01-16
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.179
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical protein Atu2016
    Species: Agrobacterium tumefaciens str. [TaxId:176299]
    Gene: AGR_C_3656, Atu2016
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8UDV3 (4-End)
      • cloning artifact (0-3)
      • modified residue (4)
      • modified residue (23)
      • modified residue (62)
      • modified residue (82)
      • modified residue (85)
      • modified residue (112)
    Domains in SCOPe 2.08: d2ob5a1, d2ob5a2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2ob5A (A:)
yfqgmlknidpalnadvlhalramghgdtlvisdtnfpsdsvarqttvgkvlhidnvsaa
ramkailsvlpldtplqpsvgrmevmgapdqlepvqvevqqeidaaegksapmygierfa
fyekakqaycvittgetrfygcflltkgvippk

    Sequence, based on observed residues (ATOM records): (download) 
    >2ob5A (A:)
yfqgmlknidpalnadvlhalramghgdtlvisdtnfpsdsvarqttvgkvlhidnvsaa
ramkailsvlpldtplqpsvgrmevmgapdqlepvqvevqqeidaaegksapmygierfa
fyekakqaycvittgetrfygcflltkgvip