PDB entry 2ob4

View 2ob4 on RCSB PDB site
Description: Human Ubiquitin-Conjugating Enzyme CDC34
Class: ligase
Keywords: ligase; ubl conjugation pathway; structural genomics consortium, sgc, ligase
Deposited on 2006-12-18, released 2006-12-26
The last revision prior to the SCOPe 2.05 freeze date was dated 2012-11-28, with a file datestamp of 2012-11-23.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.226
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ubiquitin-conjugating enzyme E2-32 kDa complementing
    Species: Homo sapiens [TaxId:9606]
    Gene: CDC34, UBE2R1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2ob4a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ob4A (A:)
    gspssqkalllelkglqeepvegfrvtlvdegdlynwevaifgppntyyeggyfkarlkf
    pidypysppafrfltkmwhpniyetgdvcisilhppvddpqsgelpserwnptqnvrtil
    lsvisllnepntfspanvdasvmyrkwkeskgkdreytdiirkqvlgtkvdaerdgvkvp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ob4A (A:)
    sqkalllelkglqeepvegfrvtlvdegdlynwevaifgppntyyeggyfkarlkfpidy
    pysppafrfltkmwhpniyetgdvcisilhppvqnvrtillsvisllnepntfspanvda
    svmyrkwkeskgkdreytdiirkqvlgtkvdaerdgv