PDB entry 2oau

View 2oau on RCSB PDB site
Description: Mechanosensitive Channel of Small Conductance (MscS)
Class: membrane protein
Keywords: stretch activated, mechanosensitive ion channel, membrane protein
Deposited on 2006-12-17, released 2007-01-09
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 3.7 Å
R-factor: 0.293
AEROSPACI score: 0.09 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Small-conductance mechanosensitive channel
    Species: Escherichia coli [TaxId:562]
    Gene: mscS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2oaua1, d2oaua2, d2oaua3
  • Chain 'B':
    Compound: Small-conductance mechanosensitive channel
    Species: Escherichia coli [TaxId:562]
    Gene: mscS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2oaub1, d2oaub2, d2oaub3
  • Chain 'C':
    Compound: Small-conductance mechanosensitive channel
    Species: Escherichia coli [TaxId:562]
    Gene: mscS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2oauc1, d2oauc2, d2oauc3
  • Chain 'D':
    Compound: Small-conductance mechanosensitive channel
    Species: Escherichia coli [TaxId:562]
    Gene: mscS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2oaud1, d2oaud2, d2oaud3
  • Chain 'E':
    Compound: Small-conductance mechanosensitive channel
    Species: Escherichia coli [TaxId:562]
    Gene: mscS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2oaue1, d2oaue2, d2oaue3
  • Chain 'F':
    Compound: Small-conductance mechanosensitive channel
    Species: Escherichia coli [TaxId:562]
    Gene: mscS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2oauf1, d2oauf2, d2oauf3
  • Chain 'G':
    Compound: Small-conductance mechanosensitive channel
    Species: Escherichia coli [TaxId:562]
    Gene: mscS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2oaug1, d2oaug2, d2oaug3

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2oauA (A:)
    mgsshhhhhhssglvprgshmedlnvvdsingagswlvanqalllsyavnivaalaiiiv
    gliiarmisnavnrlmisrkidatvadflsalvrygiiaftliaalgrvgvqtasviavl
    gaaglavglalqgslsnlaagvllvmfrpfrageyvdlggvagtvlsvqifsttmrtadg
    kiivipngkiiagniinfsrepvrrnefiigvaydsdidqvkqiltniiqsedrilkdre
    mtvrlnelgassinfvvrvwsnsgdlqnvywdvlerikrefdaagisfpypqmdvnfkrv
    kedkaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2oauA (A:)
    yavnivaalaiiivgliiarmisnavnrlmisrkidatvadflsalvrygiiaftliaal
    grvgvqtasviavlgaaglavglalqgslsnlaagvllvmfrpfrageyvdlggvagtvl
    svqifsttmrtadgkiivipngkiiagniinfsrepvrrnefiigvaydsdidqvkqilt
    niiqsedrilkdremtvrlnelgassinfvvrvwsnsgdlqnvywdvlerikrefdaagi
    sfpypqmdvnfkrv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2oauB (B:)
    mgsshhhhhhssglvprgshmedlnvvdsingagswlvanqalllsyavnivaalaiiiv
    gliiarmisnavnrlmisrkidatvadflsalvrygiiaftliaalgrvgvqtasviavl
    gaaglavglalqgslsnlaagvllvmfrpfrageyvdlggvagtvlsvqifsttmrtadg
    kiivipngkiiagniinfsrepvrrnefiigvaydsdidqvkqiltniiqsedrilkdre
    mtvrlnelgassinfvvrvwsnsgdlqnvywdvlerikrefdaagisfpypqmdvnfkrv
    kedkaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2oauB (B:)
    yavnivaalaiiivgliiarmisnavnrlmisrkidatvadflsalvrygiiaftliaal
    grvgvqtasviavlgaaglavglalqgslsnlaagvllvmfrpfrageyvdlggvagtvl
    svqifsttmrtadgkiivipngkiiagniinfsrepvrrnefiigvaydsdidqvkqilt
    niiqsedrilkdremtvrlnelgassinfvvrvwsnsgdlqnvywdvlerikrefdaagi
    sfpypqmdvnfkrv
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2oauC (C:)
    mgsshhhhhhssglvprgshmedlnvvdsingagswlvanqalllsyavnivaalaiiiv
    gliiarmisnavnrlmisrkidatvadflsalvrygiiaftliaalgrvgvqtasviavl
    gaaglavglalqgslsnlaagvllvmfrpfrageyvdlggvagtvlsvqifsttmrtadg
    kiivipngkiiagniinfsrepvrrnefiigvaydsdidqvkqiltniiqsedrilkdre
    mtvrlnelgassinfvvrvwsnsgdlqnvywdvlerikrefdaagisfpypqmdvnfkrv
    kedkaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2oauC (C:)
    yavnivaalaiiivgliiarmisnavnrlmisrkidatvadflsalvrygiiaftliaal
    grvgvqtasviavlgaaglavglalqgslsnlaagvllvmfrpfrageyvdlggvagtvl
    svqifsttmrtadgkiivipngkiiagniinfsrepvrrnefiigvaydsdidqvkqilt
    niiqsedrilkdremtvrlnelgassinfvvrvwsnsgdlqnvywdvlerikrefdaagi
    sfpypqmdvnfkrv
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2oauD (D:)
    mgsshhhhhhssglvprgshmedlnvvdsingagswlvanqalllsyavnivaalaiiiv
    gliiarmisnavnrlmisrkidatvadflsalvrygiiaftliaalgrvgvqtasviavl
    gaaglavglalqgslsnlaagvllvmfrpfrageyvdlggvagtvlsvqifsttmrtadg
    kiivipngkiiagniinfsrepvrrnefiigvaydsdidqvkqiltniiqsedrilkdre
    mtvrlnelgassinfvvrvwsnsgdlqnvywdvlerikrefdaagisfpypqmdvnfkrv
    kedkaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2oauD (D:)
    yavnivaalaiiivgliiarmisnavnrlmisrkidatvadflsalvrygiiaftliaal
    grvgvqtasviavlgaaglavglalqgslsnlaagvllvmfrpfrageyvdlggvagtvl
    svqifsttmrtadgkiivipngkiiagniinfsrepvrrnefiigvaydsdidqvkqilt
    niiqsedrilkdremtvrlnelgassinfvvrvwsnsgdlqnvywdvlerikrefdaagi
    sfpypqmdvnfkrv
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2oauE (E:)
    mgsshhhhhhssglvprgshmedlnvvdsingagswlvanqalllsyavnivaalaiiiv
    gliiarmisnavnrlmisrkidatvadflsalvrygiiaftliaalgrvgvqtasviavl
    gaaglavglalqgslsnlaagvllvmfrpfrageyvdlggvagtvlsvqifsttmrtadg
    kiivipngkiiagniinfsrepvrrnefiigvaydsdidqvkqiltniiqsedrilkdre
    mtvrlnelgassinfvvrvwsnsgdlqnvywdvlerikrefdaagisfpypqmdvnfkrv
    kedkaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2oauE (E:)
    yavnivaalaiiivgliiarmisnavnrlmisrkidatvadflsalvrygiiaftliaal
    grvgvqtasviavlgaaglavglalqgslsnlaagvllvmfrpfrageyvdlggvagtvl
    svqifsttmrtadgkiivipngkiiagniinfsrepvrrnefiigvaydsdidqvkqilt
    niiqsedrilkdremtvrlnelgassinfvvrvwsnsgdlqnvywdvlerikrefdaagi
    sfpypqmdvnfkrv
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2oauF (F:)
    mgsshhhhhhssglvprgshmedlnvvdsingagswlvanqalllsyavnivaalaiiiv
    gliiarmisnavnrlmisrkidatvadflsalvrygiiaftliaalgrvgvqtasviavl
    gaaglavglalqgslsnlaagvllvmfrpfrageyvdlggvagtvlsvqifsttmrtadg
    kiivipngkiiagniinfsrepvrrnefiigvaydsdidqvkqiltniiqsedrilkdre
    mtvrlnelgassinfvvrvwsnsgdlqnvywdvlerikrefdaagisfpypqmdvnfkrv
    kedkaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2oauF (F:)
    yavnivaalaiiivgliiarmisnavnrlmisrkidatvadflsalvrygiiaftliaal
    grvgvqtasviavlgaaglavglalqgslsnlaagvllvmfrpfrageyvdlggvagtvl
    svqifsttmrtadgkiivipngkiiagniinfsrepvrrnefiigvaydsdidqvkqilt
    niiqsedrilkdremtvrlnelgassinfvvrvwsnsgdlqnvywdvlerikrefdaagi
    sfpypqmdvnfkrv
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2oauG (G:)
    mgsshhhhhhssglvprgshmedlnvvdsingagswlvanqalllsyavnivaalaiiiv
    gliiarmisnavnrlmisrkidatvadflsalvrygiiaftliaalgrvgvqtasviavl
    gaaglavglalqgslsnlaagvllvmfrpfrageyvdlggvagtvlsvqifsttmrtadg
    kiivipngkiiagniinfsrepvrrnefiigvaydsdidqvkqiltniiqsedrilkdre
    mtvrlnelgassinfvvrvwsnsgdlqnvywdvlerikrefdaagisfpypqmdvnfkrv
    kedkaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2oauG (G:)
    yavnivaalaiiivgliiarmisnavnrlmisrkidatvadflsalvrygiiaftliaal
    grvgvqtasviavlgaaglavglalqgslsnlaagvllvmfrpfrageyvdlggvagtvl
    svqifsttmrtadgkiivipngkiiagniinfsrepvrrnefiigvaydsdidqvkqilt
    niiqsedrilkdremtvrlnelgassinfvvrvwsnsgdlqnvywdvlerikrefdaagi
    sfpypqmdvnfkrv