PDB entry 2oaf

View 2oaf on RCSB PDB site
Description: Crystal structure of thioesterase superfamily (YP_508616.1) from Jannaschia sp. CCS1 at 2.00 A resolution
Class: hydrolase
Keywords: YP_508616.1, thioesterase superfamily, Structural Genomics, Joint Center for Structural Genomics, JCSG, Protein Structure Initiative, PSI-2, HYDROLASE
Deposited on 2006-12-15, released 2007-02-13
The last revision prior to the SCOPe 2.02 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.168
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thioesterase superfamily
    Species: Jannaschia sp. [TaxId:290400]
    Gene: YP_508616.1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q28UM1 (8-150)
      • modified residue (8)
      • modified residue (77)
    Domains in SCOPe 2.02: d2oafa1
  • Chain 'B':
    Compound: Thioesterase superfamily
    Species: Jannaschia sp. [TaxId:290400]
    Gene: YP_508616.1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q28UM1 (8-150)
      • see remark 999 (7)
      • modified residue (8)
      • modified residue (77)
    Domains in SCOPe 2.02: d2oafb_
  • Heterogens: PO4, CL, CIT, PGE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2oafA (A:)
    gmqgagrlmqprpdsafvhdvrvtwgdcdpakiaytghlprfaleaidawwseyhgpggw
    yhleldtnvgtpfvrlemdfkspvtprhilkchtwptrlgtksitfrvdgvqdgvtcfvg
    aftcvftiadqfksqpapdhlraliephipa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2oafA (A:)
    mqprpdsafvhdvrvtwgdcdpakiaytghlprfaleaidawwseyhgpggwyhleldtn
    vgtpfvrlemdfkspvtprhilkchtwptrlgtksitfrvdgvqdgvtcfvgaftcvfti
    adqfksqpapdhlraliephipa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2oafB (B:)
    gmqgagrlmqprpdsafvhdvrvtwgdcdpakiaytghlprfaleaidawwseyhgpggw
    yhleldtnvgtpfvrlemdfkspvtprhilkchtwptrlgtksitfrvdgvqdgvtcfvg
    aftcvftiadqfksqpapdhlraliephipa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2oafB (B:)
    lmqprpdsafvhdvrvtwgdcdpakiaytghlprfaleaidawwseyhgpggwyhleldt
    nvgtpfvrlemdfkspvtprhilkchtwptrlgtksitfrvdgvqdgvtcfvgaftcvft
    iadqfksqpapdhlraliephipa