PDB entry 2oad

View 2oad on RCSB PDB site
Description: Structure of Glutathione-S-Transferase C169A Mutant
Class: transferase
Keywords: enzyme and ligand complex, Transferase
Deposited on 2006-12-15, released 2007-01-23
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-07-24, with a file datestamp of 2019-07-19.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glutathione S-transferase P 1
    Species: Mus musculus [TaxId:10090]
    Gene: Gstp1, Gstpib
    Database cross-references and differences (RAF-indexed):
    • Uniprot P19157 (0-208)
      • engineered (168)
    Domains in SCOPe 2.08: d2oada1, d2oada2
  • Chain 'B':
    Compound: Glutathione S-transferase P 1
    Species: Mus musculus [TaxId:10090]
    Gene: Gstp1, Gstpib
    Database cross-references and differences (RAF-indexed):
    • Uniprot P19157 (0-208)
      • engineered (168)
    Domains in SCOPe 2.08: d2oadb1, d2oadb2
  • Heterogens: GTB, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2oadA (A:)
    ppytivyfpvrgrceamrmlladqgqswkeevvtidtwmqgllkptclygqlpkfedgdl
    tlyqsnailrhlgrslglygknqreaaqmdmvndgvedlrgkyvtliytnyengkndyvk
    alpghlkpfetllsqnqggkafivgdqisfadynlldlllihqvlapgaldnfpllsayv
    arlsarpkikaflsspehvnrpingngkq
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2oadB (B:)
    ppytivyfpvrgrceamrmlladqgqswkeevvtidtwmqgllkptclygqlpkfedgdl
    tlyqsnailrhlgrslglygknqreaaqmdmvndgvedlrgkyvtliytnyengkndyvk
    alpghlkpfetllsqnqggkafivgdqisfadynlldlllihqvlapgaldnfpllsayv
    arlsarpkikaflsspehvnrpingngkq