PDB entry 2oa4

View 2oa4 on RCSB PDB site
Description: Solution NMR Structure: Northeast Structural Genomics Consortium Target SiR5
Class: structural genomics, unknown function
Keywords: SiR5, NMR structure, Structural Genomics, PSI-2, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG, UNKNOWN FUNCTION
Deposited on 2006-12-14, released 2007-03-06
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: SiR5
  Species: Silicibacter pomeroyi [TaxId:89184]
  Gene: SPO1678
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q5LST8 (0-92)
    • see remark 999 (58)
    • cloning artifact (93-94)
    • expression tag (95-100)
  Domains in SCOPe 2.08: d2oa4a1, d2oa4a2

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2oa4A (A:)
  mmflrkvegprsvtlpdgsimtradlppantrrwvasrkiavvrgviyglitlaeakqty
  glsdeefnswvsalaehgkdalkvtalkkyrqllehhhhhh