PDB entry 2o9v

View 2o9v on RCSB PDB site
Description: The second SH3 domain from Ponsin in complex with the paxillin proline rich region
Class: signaling protein/cell adhesion
Keywords: SH3 DOMAIN, PONSIN, Paxillin, proline-rich-region, SIGNALING PROTEIN/CELL ADHESION COMPLEX
Deposited on 2006-12-14, released 2007-10-30
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.63 Å
R-factor: 0.144
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ponsin
    Species: Homo sapiens [TaxId:9606]
    Gene: SORBS1
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0AED4 (6-66)
      • expression tag (0-5)
    Domains in SCOPe 2.06: d2o9va1, d2o9va2
  • Chain 'B':
    Compound: Paxillin
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2o9vA (A:)
    gidpftgeaiakfnfngdtqvemsfrkgeritllrqvdenwyegripgtsrqgifpityv
    dvikrpl
    

  • Chain 'B':
    No sequence available.