PDB entry 2o9u

View 2o9u on RCSB PDB site
Description: Monellin (MNEI) at 1.15 resolution
Class: plant protein
Keywords: alternative conformations, 3-10 polyproline II helix, PLANT PROTEIN
Deposited on 2006-12-14, released 2007-02-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-08-16, with a file datestamp of 2017-08-11.
Experiment type: XRAY
Resolution: 1.1500000000000001 Å
R-factor: N/A
AEROSPACI score: 0.68 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'X':
    Compound: Monellin chain B and Monellin chain A
    Species: Dioscoreophyllum cumminsii [TaxId:3457]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02882 (1-50)
      • see remark 999 (49-50)
      • linker (51)
    • Uniprot P02881 (52-96)
    Domains in SCOPe 2.08: d2o9ux_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >2o9uX (X:)
    mgeweiidigpftqnlgkfavdeenkigqygrltfnkvirpcmkktiyenegfreikgye
    yqlyvyasdklfradisedyktrgrkllrfngpvppp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2o9uX (X:)
    geweiidigpftqnlgkfavdeenkigqygrltfnkvirpcmkktiyenegfreikgyey
    qlyvyasdklfradisedyktrgrkllrfngpvppp