PDB entry 2o9s

View 2o9s on RCSB PDB site
Description: The second SH3 domain from ponsin
Class: signaling protein
Keywords: sh3 domain, ponsin, signaling protein
Deposited on 2006-12-14, released 2007-10-30
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 0.83 Å
R-factor: 0.105
AEROSPACI score: 1.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ponsin
    Species: Homo sapiens [TaxId:9606]
    Gene: SORBS1
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0AED4 (6-66)
      • expression tag (0-5)
    Domains in SCOPe 2.06: d2o9sa1, d2o9sa2
  • Heterogens: NA, CL, SCN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2o9sA (A:)
    gidpftgeaiakfnfngdtqvemsfrkgeritllrqvdenwyegripgtsrqgifpityv
    dvikrpl