PDB entry 2o9q

View 2o9q on RCSB PDB site
Description: The crystal structure of Bovine Trypsin complexed with a small inhibition peptide ORB2K
Class: hydrolase
Keywords: trypsin, inhibitor, HYDROLASE
Deposited on 2006-12-14, released 2007-12-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cationic trypsin
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2o9qa_
  • Chain 'C':
    Compound: orb2k
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 2O9Q
  • Heterogens: CA, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2o9qA (A:)
    ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
    neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
    wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
    vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn
    

  • Chain 'C':
    No sequence available.