PDB entry 2o99

View 2o99 on RCSB PDB site
Description: The crystal structure of E.coli IclR C-terminal fragment in complex with glyoxylate
Class: DNA binding protein
Keywords: IclR, DNA BINDING PROTEIN
Deposited on 2006-12-13, released 2007-04-10
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.207
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Acetate operon repressor
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P16528 (3-179)
      • cloning artifact (0-2)
      • modified residue (18)
      • modified residue (27)
      • modified residue (49)
      • modified residue (51)
      • modified residue (61)
      • modified residue (163)
      • modified residue (178)
      • cloning artifact (180-181)
    Domains in SCOPe 2.06: d2o99a2, d2o99a3, d2o99a4
  • Chain 'B':
    Compound: Acetate operon repressor
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P16528 (3-End)
      • cloning artifact (0-2)
      • modified residue (18)
      • modified residue (27)
      • modified residue (49)
      • modified residue (51)
      • modified residue (61)
      • modified residue (163)
      • modified residue (178)
    Domains in SCOPe 2.06: d2o99b2, d2o99b3
  • Chain 'C':
    Compound: Acetate operon repressor
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P16528 (3-179)
      • cloning artifact (0-2)
      • modified residue (18)
      • modified residue (27)
      • modified residue (49)
      • modified residue (51)
      • modified residue (61)
      • modified residue (163)
      • modified residue (178)
      • cloning artifact (180-181)
    Domains in SCOPe 2.06: d2o99c2, d2o99c3, d2o99c4
  • Chain 'D':
    Compound: Acetate operon repressor
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P16528 (3-179)
      • cloning artifact (2)
      • modified residue (18)
      • modified residue (27)
      • modified residue (49)
      • modified residue (51)
      • modified residue (61)
      • modified residue (163)
      • modified residue (178)
    Domains in SCOPe 2.06: d2o99d2, d2o99d3
  • Heterogens: EDO, GOA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2o99A (A:)
    ghmsrnllaivhpilrnlmeesgetvnmavldqsdheaiiidqvqcthlmrmsapiggkl
    pmhasgagkaflaqlseeqvtkllhrkglhaythatlvspvhlkedlaqtrkrgysfdde
    ehalglrclaacifdehrepfaaisisgpisritddrvtefgamvikaakevtlayggmr
    gs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2o99A (A:)
    ghmsrnllaivhpilrnlmeesgetvnmavldqsdheaiiidqvqcthlmrmsapiggkl
    pmhasgagkaflaqlseeqvtkkglhaythatlvspvhlkedlaqtrkrgysfddeehal
    glrclaacifdehrepfaaisisgpisritddrvtefgamvikaakevtlayggmrgs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2o99B (B:)
    ghmsrnllaivhpilrnlmeesgetvnmavldqsdheaiiidqvqcthlmrmsapiggkl
    pmhasgagkaflaqlseeqvtkllhrkglhaythatlvspvhlkedlaqtrkrgysfdde
    ehalglrclaacifdehrepfaaisisgpisritddrvtefgamvikaakevtlayggmr
    gs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2o99B (B:)
    ghmsrnllaivhpilrnlmeesgetvnmavldqsdheaiiidqvqcthlmrmsapiggkl
    pmhasgagkaflaqlseeqvtkllhrkglhaythatlvspvhlkedlaqtrkrgysfdde
    ehalglrclaacifdehrepfaaisisgpisritddrvtefgamvikaakevtlayggm
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2o99C (C:)
    ghmsrnllaivhpilrnlmeesgetvnmavldqsdheaiiidqvqcthlmrmsapiggkl
    pmhasgagkaflaqlseeqvtkllhrkglhaythatlvspvhlkedlaqtrkrgysfdde
    ehalglrclaacifdehrepfaaisisgpisritddrvtefgamvikaakevtlayggmr
    gs
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2o99D (D:)
    ghmsrnllaivhpilrnlmeesgetvnmavldqsdheaiiidqvqcthlmrmsapiggkl
    pmhasgagkaflaqlseeqvtkllhrkglhaythatlvspvhlkedlaqtrkrgysfdde
    ehalglrclaacifdehrepfaaisisgpisritddrvtefgamvikaakevtlayggmr
    gs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2o99D (D:)
    msrnllaivhpilrnlmeesgetvnmavldqsdheaiiidqvqcthlmrmsapiggklpm
    hasgagkaflaqlseeqvtkllhrkglhaythatlvspvhlkedlaqtrkrgysfddeeh
    alglrclaacifdehrepfaaisisgpisritddrvtefgamvikaakevtlayggmr