PDB entry 2o8r

View 2o8r on RCSB PDB site
Description: Crystal Structure of Polyphosphate Kinase from Porphyromonas Gingivalis
Class: transferase
Keywords: KINASE, STRUCTURAL GENOMICS, PROTEIN STRUCTURE INITIATIVE, PSI, NYSGRC, NEW YORK STRUCTURAL GENOMICS RESEARCH CONSORTIUM, New York SGX Research Center for Structural Genomics, NYSGXRC, TRANSFERASE
Deposited on 2006-12-12, released 2006-12-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.19
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Polyphosphate kinase
    Species: Porphyromonas gingivalis [TaxId:837]
    Gene: ppk
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7MTR1
      • engineered (14)
      • engineered (25)
      • engineered (145)
      • engineered (226)
      • engineered (269)
      • engineered (274)
      • engineered (307)
      • engineered (336)
      • engineered (361)
      • engineered (421)
      • engineered (432)
      • engineered (479)
      • engineered (515)
      • engineered (538)
      • engineered (542)
      • engineered (578)
      • engineered (592)
      • engineered (618)
      • engineered (636)
      • engineered (691)
    Domains in SCOPe 2.07: d2o8ra1, d2o8ra2, d2o8ra3, d2o8ra4
  • Chain 'B':
    Compound: Polyphosphate kinase
    Species: Porphyromonas gingivalis [TaxId:837]
    Gene: ppk
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7MTR1
      • engineered (14)
      • engineered (25)
      • engineered (145)
      • engineered (226)
      • engineered (269)
      • engineered (274)
      • engineered (307)
      • engineered (336)
      • engineered (361)
      • engineered (421)
      • engineered (432)
      • engineered (479)
      • engineered (515)
      • engineered (538)
      • engineered (542)
      • engineered (578)
      • engineered (592)
      • engineered (636)
      • engineered (691)
    Domains in SCOPe 2.07: d2o8rb1, d2o8rb2, d2o8rb3, d2o8rb4
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2o8rA (A:)
    msldvsaypffrrdmswlsfnervlmeaadrtlpvydrikflsifssnleefytvrvayh
    qavlqkrrdrseaeedsdadahilqairetvirqdelyyrifydqilptleehgirlrth
    apthpdhkaylrrffheeifpllypmlllpskvrtfirsgrvylavrlkeketdeaysya
    llnvptdglprfvelprlqtdtfyyysflediikehldvvfpgyevmdsysikvsrdadl
    lldaqrpedlpgeirkkvktrklgaptrfmydgrmpdevlryicsscdidpeeairsgny
    vnlqdlamlpnpfaprletltpepllskhleqapslmegirrkdylihvpyytydyvvrl
    lmeaaispdvseirltqyrvaenssiisaleaaaqsgkkvsvfvelkarfdeennlrlse
    rmrrsgirivysmpglkvhaktalilyhtpagerpqgiallstgnfnettariysdttlm
    tantdivhdvyrlfrildgdpeparfsrllvarynmgeaitnliereienvkrgkrgyml
    lkmnglqdknvitqlyraseagveidlivrgicclvpdmpqsrnirvtrlvdmylehsri
    wcfhnggkeevfissadwmkrnlynrietacpvldptlrreiidileiqlrdnikacrid
    sslnniykhnsdekpvraqaaiyrylkgkeettpaakeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2o8rA (A:)
    saypffrrdmswlsfnervlmeaadrtlpvydrikflsifssnleefytvrvayhqavlq
    khilqairetvirqdelyyrifydqilptleehgirlrthapthpdhkaylrrffheeif
    pllypmlllpskvrtfirsgrvylavrlkeketdeaysyallnvptdglprfvelprlqt
    dtfyyysflediikehldvvfpgyevmdsysikvsrdadllldaptrfmydgrmpdevlr
    yicsscdidpeeairsgnyvnlqdlamlpnpfaprletltpepllskhleqapslmegir
    rkdylihvpyytydyvvrllmeaaispdvseirltqyrvaenssiisaleaaaqsgkkvs
    vfvelkarfnlrlsermrrsgirivysmpglkvhaktalilyhtpagerpqgiallstgn
    fnettariysdttlmtantdivhdvyrlfrildgdpeparfsrllvarynmgeaitnlie
    reienvkrgkrgymllkmnglqdknvitqlyraseagveidlivrgicclvpdmpqsrni
    rvtrlvdmylehsriwcfhnggkeevfissadwmkrnlynrietacpvldptlrreiidi
    leiqlrdnikacridsslnniykhnsdekpvraqaaiyrylkgkeett
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2o8rB (B:)
    msldvsaypffrrdmswlsfnervlmeaadrtlpvydrikflsifssnleefytvrvayh
    qavlqkrrdrseaeedsdadahilqairetvirqdelyyrifydqilptleehgirlrth
    apthpdhkaylrrffheeifpllypmlllpskvrtfirsgrvylavrlkeketdeaysya
    llnvptdglprfvelprlqtdtfyyysflediikehldvvfpgyevmdsysikvsrdadl
    lldaqrpedlpgeirkkvktrklgaptrfmydgrmpdevlryicsscdidpeeairsgny
    vnlqdlamlpnpfaprletltpepllskhleqapslmegirrkdylihvpyytydyvvrl
    lmeaaispdvseirltqyrvaenssiisaleaaaqsgkkvsvfvelkarfdeennlrlse
    rmrrsgirivysmpglkvhaktalilyhtpagerpqgiallstgnfnettariysdttlm
    tantdivhdvyrlfrildgdpeparfsrllvarynmgeaitnliereienvkrgkrgyml
    lkmnglqdknvitqlyraseagveidlivrgicclvpdmpqsrnirvtrlvdmylehsri
    wcfhnggkeevfissadwmkrnlynrietacpvldptlrreiidileiqlrdnikacrid
    sslnniykhnsdekpvraqaaiyrylkgkeettpaakeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2o8rB (B:)
    rdmswlsfnervlmeaadrtlpvydrikflsifssnleefytvrvaylqairetvirqde
    lyyrifydqilptleehgirlrthapthpdhkaylrrffheeifpllypmlllpskvrtf
    irsgrvylavrlkeketdeaysyallnvptdglprfvelprlqtdtfyyysflediikeh
    ldvvfpgyevmdsysikvsrptrfmydgrmpdevlryiairsgnyvnlqdlamlpnpfap
    rletltpepllskhleqapslmegirrkdylihvpyytydyvvrllmeaaispdvseirl
    tqyrvaenssiisaleaaaqsgkkvsvfvelkarfdeennlrlsermrrsgirivysmpg
    lkvhaktalilyhtpagerpqgiallstgnfnettariysdttlmtantdivhdvyrlfr
    ildgdpeparfsrllvarynmgeaitnliereienvkrgkrgymllkmnglqdknvitql
    yraseagveidlivrgicclvpdmpqsrnirvtrlvdmylehsriwcfhnggkeevfiss
    adwlynrietacpvldptlrreiidileiqlrdnikaciykhnsdekpvraqaaiyrylk
    gkeet