PDB entry 2o8i

View 2o8i on RCSB PDB site
Description: Crystal structure of protein Atu2327 from Agrobacterium tumefaciens str. C58
Class: structural genomics, unknown function
Keywords: Atu2327, Agrobacterium tumefaciens str. C58, Structural Genomics, PSI-2, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, UNKNOWN FUNCTION
Deposited on 2006-12-12, released 2007-01-09
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.212
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical protein Atu2327
    Species: Agrobacterium tumefaciens str. [TaxId:176299]
    Gene: AGR_C_4230, Atu2327
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8UD01 (0-164)
      • engineered (0)
      • engineered (160)
    Domains in SCOPe 2.08: d2o8ia1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2o8iA (A:)
    mvtreefvarfggvfehspfiaeraydaggagleltakavhgalcaqfrvaseaerlgvl
    rahpdlagklaiageltadsrneqagagldrlspqeharftqlnsaytekfgfpfiiavk
    glnrhdilsafdtridnnaaqefatatgqvekiawlrlasmlpeg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2o8iA (A:)
    mvtreefvarfggvfehspfiaeraydaggagleltakavhgalcaqfrvaseaerlgvl
    rahpdlagklaiageltgldrlspqeharftqlnsaytekfgfpfiiavkglnrhdilsa
    fdtridnnaaqefatatgqvekiawlrlasmlpeg