PDB entry 2o84

View 2o84 on RCSB PDB site
Description: Crystal structure of K206E mutant of N-lobe human transferrin
Class: metal transport
Keywords: Human transferrin, iron binding and release, dilysine pair, METAL TRANSPORT
Deposited on 2006-12-12, released 2007-01-23
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.216
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'X':
    Compound: serotransferrin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02787
      • engineered (205)
    Domains in SCOPe 2.03: d2o84x_
  • Heterogens: FE, CO3, K, HOH

PDB Chain Sequences:

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >2o84X (X:)
    vpdktvrwcavseheatkcqsfrdhmksvipsdgpsvacvkkasyldciraiaaneadav
    tldaglvydaylapnnlkpvvaefygskedpqtfyyavavvkkdsgfqmnqlrgkkscht
    glgrsagwnipigllycdlpeprkplekavanffsgscapcadgtdfpqlcqlcpgcgcs
    tlnqyfgysgafkclkdgagdvafvehstifenlankadrdqyellcldntrkpvdeykd
    chlaqvpshtvvarsmggkedliwellnqaqehfgkdkskefqlfssphgkdllfkdsah
    gflkvpprmdakmylgyeyvtairnlregtcpeaptd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2o84X (X:)
    dktvrwcavseheatkcqsfrdhmksvipsdgpsvacvkkasyldciraiaaneadavtl
    daglvydaylapnnlkpvvaefygskedpqtfyyavavvkkdsgfqmnqlrgkkschtgl
    grsagwnipigllycdlpeprkplekavanffsgscapcadgtdfpqlcqlcpgcgcstl
    nqyfgysgafkclkdgagdvafvehstifenlankadrdqyellcldntrkpvdeykdch
    laqvpshtvvarsmggkedliwellnqaqehfgkdkskefqlfssphgkdllfkdsahgf
    lkvpprmdakmylgyeyvtairnlregtc