PDB entry 2o7c

View 2o7c on RCSB PDB site
Description: Crystal structure of L-methionine-lyase from Pseudomonas
Class: lyase
Keywords: PLP, Methionine, Cancer, LYASE
Deposited on 2006-12-10, released 2007-12-11
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.204
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: methionine gamma-lyase
    Species: Pseudomonas putida [TaxId:303]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2o7ca_
  • Chain 'B':
    Compound: methionine gamma-lyase
    Species: Pseudomonas putida [TaxId:303]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2o7cb_
  • Chain 'C':
    Compound: methionine gamma-lyase
    Species: Pseudomonas putida [TaxId:303]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2o7cc_
  • Chain 'D':
    Compound: methionine gamma-lyase
    Species: Pseudomonas putida [TaxId:303]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2o7cd_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2o7cA (A:)
    mhgsnklpgfatraihhgydpqdhggalvppvyqtatftfptveygaacfageqaghfys
    risnptlnllearmasleggeaglalasgmgaitstlwtllrpgdevllgntlygctfaf
    lhhgigefgvklrhvdmadlqaleaamtpatrviyfespanpnmhmadiagvakiarkhg
    atvvvdntyctpylqrplelgadlvvhsatkylsghgditagivvgsqalvdrirlqglk
    dmtgavlsphdaallmrgiktlnlrmdrhcanaqvlaeflarqpqvelihypglasfpqy
    tlarqqmsqpggmiafelkggigagrrfmnalqlfsravslgdaeslaqhpasmthssyt
    peerahygiseglvrlsvglediddlladvqqalkasa
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2o7cB (B:)
    mhgsnklpgfatraihhgydpqdhggalvppvyqtatftfptveygaacfageqaghfys
    risnptlnllearmasleggeaglalasgmgaitstlwtllrpgdevllgntlygctfaf
    lhhgigefgvklrhvdmadlqaleaamtpatrviyfespanpnmhmadiagvakiarkhg
    atvvvdntyctpylqrplelgadlvvhsatkylsghgditagivvgsqalvdrirlqglk
    dmtgavlsphdaallmrgiktlnlrmdrhcanaqvlaeflarqpqvelihypglasfpqy
    tlarqqmsqpggmiafelkggigagrrfmnalqlfsravslgdaeslaqhpasmthssyt
    peerahygiseglvrlsvglediddlladvqqalkasa
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2o7cC (C:)
    mhgsnklpgfatraihhgydpqdhggalvppvyqtatftfptveygaacfageqaghfys
    risnptlnllearmasleggeaglalasgmgaitstlwtllrpgdevllgntlygctfaf
    lhhgigefgvklrhvdmadlqaleaamtpatrviyfespanpnmhmadiagvakiarkhg
    atvvvdntyctpylqrplelgadlvvhsatkylsghgditagivvgsqalvdrirlqglk
    dmtgavlsphdaallmrgiktlnlrmdrhcanaqvlaeflarqpqvelihypglasfpqy
    tlarqqmsqpggmiafelkggigagrrfmnalqlfsravslgdaeslaqhpasmthssyt
    peerahygiseglvrlsvglediddlladvqqalkasa
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2o7cD (D:)
    mhgsnklpgfatraihhgydpqdhggalvppvyqtatftfptveygaacfageqaghfys
    risnptlnllearmasleggeaglalasgmgaitstlwtllrpgdevllgntlygctfaf
    lhhgigefgvklrhvdmadlqaleaamtpatrviyfespanpnmhmadiagvakiarkhg
    atvvvdntyctpylqrplelgadlvvhsatkylsghgditagivvgsqalvdrirlqglk
    dmtgavlsphdaallmrgiktlnlrmdrhcanaqvlaeflarqpqvelihypglasfpqy
    tlarqqmsqpggmiafelkggigagrrfmnalqlfsravslgdaeslaqhpasmthssyt
    peerahygiseglvrlsvglediddlladvqqalkasa