PDB entry 2o6x

View 2o6x on RCSB PDB site
Description: Crystal Structure of ProCathepsin L1 from Fasciola hepatica
Class: hydrolase
Keywords: hydrolase; thiol protease; cysteine protease; zymogen, HYDROLASE
Deposited on 2006-12-08, released 2007-12-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: N/A
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Secreted cathepsin L 1
    Species: Fasciola hepatica [TaxId:6192]
    Gene: CL1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7JNQ9 (0-309)
      • engineered (115)
    Domains in SCOPe 2.07: d2o6xa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2o6xA (A:)
    nddlwhqwkrmynkeyngaddqhrrniweknvkhiqehnlrhdlglvtytlglnqftdmt
    feefkakyltemsrasdilshgvpyeannravpdkidwresgyvtevkdqgncgsgwafs
    ttgtmegqymknertsisfseqqlvdcsrpwgnngcggglmenayqylkqfgletessyp
    ytavegqcrynkqlgvakvtgfytvhsgsevelknlvgaegpaavavdvesdfmmyrsgi
    yqsqtcsplrvnhavlavgygtqggtdywivknswglswgergyirmvrnrgnmcgiasl
    aslpmvarfp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2o6xA (A:)
    nddlwhqwkrmynkeyngaddqhrrniweknvkhiqehnlrhdlglvtytlglnqftdmt
    feefkakyltemsrasdilshgvpyeavpdkidwresgyvtevkdqgncgsgwafsttgt
    megqymknertsisfseqqlvdcsrpwgnngcggglmenayqylkqfgletessypytav
    egqcrynkqlgvakvtgfytvhsgsevelknlvgaegpaavavdvesdfmmyrsgiyqsq
    tcsplrvnhavlavgygtqggtdywivknswglswgergyirmvrnrgnmcgiaslaslp
    mvarfp