PDB entry 2o6u

View 2o6u on RCSB PDB site
Description: Crystal structure of the PA5185 protein from Pseudomonas Aeruginosa strain PAO1- new crystal form.
Class: hydrolase
Keywords: putative thioesterase, hot-dog fold, HYDROLASE
Deposited on 2006-12-08, released 2007-12-11
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-12-29, with a file datestamp of 2009-12-24.
Experiment type: XRAY
Resolution: 3.01 Å
R-factor: 0.197
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: thioesterase
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: PA5185
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2o6ua1
  • Chain 'B':
    Compound: thioesterase
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: PA5185
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2o6ub1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2o6uA (A:)
    ghmataprplreqylhfqpistrwhdndiyghvnnvtyyaffdtavntylierggldiqg
    geviglvvssscdyfapvafpqriemglrvarlgnssvqyelalflegqreacaagrfvh
    vfverrssrpvaipqelrdalaalqssaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2o6uA (A:)
    rplreqylhfqpistrwhdndiyghvnnvtyyaffdtavntylierggldiqggeviglv
    vssscdyfapvafpqriemglrvarlgnssvqyelalflegqreacaagrfvhvfverrs
    srpvaipqelrdalaalqs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2o6uB (B:)
    ghmataprplreqylhfqpistrwhdndiyghvnnvtyyaffdtavntylierggldiqg
    geviglvvssscdyfapvafpqriemglrvarlgnssvqyelalflegqreacaagrfvh
    vfverrssrpvaipqelrdalaalqssaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2o6uB (B:)
    rplreqylhfqpistrwhdndiyghvnnvtyyaffdtavntylierggldiqggeviglv
    vssscdyfapvafpqriemglrvarlgnssvqyelalflegqreacaagrfvhvfverrs
    srpvaipqelrdalaalqs