PDB entry 2o6t

View 2o6t on RCSB PDB site
Description: Crystal structure of the PA5185 protein from Pseudomonas Aeruginosa strain PAO1- orthorhombic form (P2221).
Class: hydrolase
Keywords: putative thioesterase, hot-dog fold, HYDROLASE
Deposited on 2006-12-08, released 2007-12-11
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-12-29, with a file datestamp of 2009-12-24.
Experiment type: XRAY
Resolution: 2.55 Å
R-factor: 0.183
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: thioesterase
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: PA5185
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HU04 (2-End)
      • expression tag (1)
    Domains in SCOPe 2.03: d2o6ta_
  • Chain 'C':
    Compound: thioesterase
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: PA5185
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2o6tc_
  • Chain 'E':
    Compound: thioesterase
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: PA5185
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2o6te_
  • Chain 'G':
    Compound: thioesterase
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: PA5185
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2o6tg_
  • Chain 'I':
    Compound: thioesterase
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: PA5185
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HU04 (2-End)
      • expression tag (1)
    Domains in SCOPe 2.03: d2o6ti_
  • Chain 'K':
    Compound: thioesterase
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: PA5185
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2o6tk_
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2o6tA (A:)
    ghmataprplreqylhfqpistrwhdndiyghvnnvtyyaffdtavntylierggldiqg
    geviglvvssscdyfapvafpqriemglrvarlgnssvqyelalflegqreacaagrfvh
    vfverrssrpvaipqelrdalaalqssaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2o6tA (A:)
    hmataprplreqylhfqpistrwhdndiyghvnnvtyyaffdtavntylierggldiqgg
    eviglvvssscdyfapvafpqriemglrvarlgnssvqyelalflegqreacaagrfvhv
    fverrssrpvaipqelrdalaalqss
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2o6tC (C:)
    ghmataprplreqylhfqpistrwhdndiyghvnnvtyyaffdtavntylierggldiqg
    geviglvvssscdyfapvafpqriemglrvarlgnssvqyelalflegqreacaagrfvh
    vfverrssrpvaipqelrdalaalqssaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2o6tC (C:)
    aprplreqylhfqpistrwhdndiyghvnnvtyyaffdtavntylierggldiqggevig
    lvvssscdyfapvafpqriemglrvarlgnssvqyelalflegqreacaagrfvhvfver
    rssrpvaipqelrdalaalqssa
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2o6tE (E:)
    ghmataprplreqylhfqpistrwhdndiyghvnnvtyyaffdtavntylierggldiqg
    geviglvvssscdyfapvafpqriemglrvarlgnssvqyelalflegqreacaagrfvh
    vfverrssrpvaipqelrdalaalqssaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2o6tE (E:)
    prplreqylhfqpistrwhdndiyghvnnvtyyaffdtavntylierggldiqggevigl
    vvssscdyfapvafpqriemglrvarlgnssvqyelalflegqreacaagrfvhvfverr
    ssrpvaipqelrdalaalqs
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2o6tG (G:)
    ghmataprplreqylhfqpistrwhdndiyghvnnvtyyaffdtavntylierggldiqg
    geviglvvssscdyfapvafpqriemglrvarlgnssvqyelalflegqreacaagrfvh
    vfverrssrpvaipqelrdalaalqssaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2o6tG (G:)
    aprplreqylhfqpistrwhdndiyghvnnvtyyaffdtavntylierggldiqggevig
    lvvssscdyfapvafpqriemglrvarlgnssvqyelalflegqreacaagrfvhvfver
    rssrpvaipqelrdalaalqss
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >2o6tI (I:)
    ghmataprplreqylhfqpistrwhdndiyghvnnvtyyaffdtavntylierggldiqg
    geviglvvssscdyfapvafpqriemglrvarlgnssvqyelalflegqreacaagrfvh
    vfverrssrpvaipqelrdalaalqssaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2o6tI (I:)
    hmataprplreqylhfqpistrwhdndiyghvnnvtyyaffdtavntylierggldiqgg
    eviglvvssscdyfapvafpqriemglrvarlgnssvqyelalflegqreacaagrfvhv
    fverrssrpvaipqelrdalaalqs
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >2o6tK (K:)
    ghmataprplreqylhfqpistrwhdndiyghvnnvtyyaffdtavntylierggldiqg
    geviglvvssscdyfapvafpqriemglrvarlgnssvqyelalflegqreacaagrfvh
    vfverrssrpvaipqelrdalaalqssaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2o6tK (K:)
    prplreqylhfqpistrwhdndiyghvnnvtyyaffdtavntylierggldiqggevigl
    vvssscdyfapvafpqriemglrvarlgnssvqyelalflegqreacaagrfvhvfverr
    ssrpvaipqelrdalaalqssaq