PDB entry 2o6r

View 2o6r on RCSB PDB site
Description: Structural diversity of the hagfish Variable Lymphocyte Receptors B61
Class: immune system
Keywords: Leucine-rich repeat protein, LRR, IMMUNE SYSTEM
Deposited on 2006-12-08, released 2006-12-26
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.191
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Variable lymphocyte receptor B
    Species: Eptatretus burgeri [TaxId:7764]
    Gene: VLRB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2o6ra_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2o6rA (A:)
    cpsrcscsgteircnskgltsvptgipssatrlelesnklqslphgvfdkltqltklsls
    qnqiqslpdgvfdkltkltilylhenklqslpngvfdkltqlkelaldtnqlksvpdgif
    drltslqkiwlhtnpwdcscpridylsrwlnknsqkeqgsakcsgsgkpvrsiicpt