PDB entry 2o6p

View 2o6p on RCSB PDB site
Description: Crystal Structure of the heme-IsdC complex
Class: transport protein
Keywords: Beta barrel, protein-heme complex, TRANSPORT PROTEIN
Deposited on 2006-12-08, released 2007-02-06
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.195
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Iron-regulated surface determinant protein C
    Species: Staphylococcus aureus [TaxId:158879]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7A654 (2-End)
      • cloning artifact (0-1)
    Domains in SCOPe 2.05: d2o6pa1
  • Chain 'B':
    Compound: Iron-regulated surface determinant protein C
    Species: Staphylococcus aureus [TaxId:158879]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7A654 (2-End)
      • cloning artifact (0-1)
    Domains in SCOPe 2.05: d2o6pb_
  • Heterogens: ZN, CL, HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2o6pA (A:)
    gsdsgtlnyevykyntndtsiandyfnkpakyikkngklyvqitvnhshwitgmsieghk
    eniiskntakdertsefevsklngkidgkidvyidekvngkpfkydhhynitykfngptd
    vaganapgkddknsasgsdkgsdgtttgqsesnssnkdkve
    

    Sequence, based on observed residues (ATOM records): (download)
    >2o6pA (A:)
    gsdsgtlnyevykyntndtsiandyfnkpakyikkngklyvqitvnhshwitgmsieghk
    eniiskntakdertsefevsklngkidgkidvyidekvngkpfkydhhynitykfngptd
    vag
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2o6pB (B:)
    gsdsgtlnyevykyntndtsiandyfnkpakyikkngklyvqitvnhshwitgmsieghk
    eniiskntakdertsefevsklngkidgkidvyidekvngkpfkydhhynitykfngptd
    vaganapgkddknsasgsdkgsdgtttgqsesnssnkdkve
    

    Sequence, based on observed residues (ATOM records): (download)
    >2o6pB (B:)
    gsdsgtlnyevykyntndtsiandyfnkpakyikkngklyvqitvnhshwitgmsieghk
    eniiskntakdertsefevsklngkidgkidvyidekvngkpfkydhhynitykfngpt