PDB entry 2o6m

View 2o6m on RCSB PDB site
Description: H98Q mutant of the homing endonuclease I-PPOI complexed with DNA
Class: hydrolase/DNA
Keywords: homing endonuclease, homodimer, protein/DNA complex, hnh, hydrolase/DNA complex
Deposited on 2006-12-07, released 2007-10-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.211
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: intron-encoded endonuclease I-ppoi
    Species: Physarum polycephalum [TaxId:5791]
    Gene: I-PpoI
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q94702
      • engineered (97)
    Domains in SCOPe 2.08: d2o6ma_
  • Chain 'B':
    Compound: intron-encoded endonuclease I-ppoi
    Species: Physarum polycephalum [TaxId:5791]
    Gene: I-PpoI
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q94702 (Start-162)
      • engineered (97)
    Domains in SCOPe 2.08: d2o6mb_
  • Chain 'C':
    Compound: 5'-d(*dtp*dtp*dgp*dap*dcp*dtp*dcp*dtp*dcp*dtp*dtp*dap*dap*dgp*dap*dgp*dap*dgp*dtp*dcp*da)-3'
  • Chain 'D':
    Compound: 5'-d(*dtp*dtp*dgp*dap*dcp*dtp*dcp*dtp*dcp*dtp*dtp*dap*dap*dgp*dap*dgp*dap*dgp*dtp*dcp*da)-3'
  • Heterogens: ZN, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2o6mA (A:)
    maltnaqilavidsweetvgqfpvithhvplggglqgtlhcyeiplaapygvgfakngpt
    rwqykrtinqvvhrwgshtvpfllepdningktctasqlchntrchnplhlcweslddnk
    grnwcpgpnggcvhavvclrqgplygpgatvagpqqrgshfvv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2o6mA (A:)
    altnaqilavidsweetvgqfpvithhvplggglqgtlhcyeiplaapygvgfakngptr
    wqykrtinqvvhrwgshtvpfllepdningktctasqlchntrchnplhlcweslddnkg
    rnwcpgpnggcvhavvclrqgplygpgatvagpqqrgshfvv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2o6mB (B:)
    maltnaqilavidsweetvgqfpvithhvplggglqgtlhcyeiplaapygvgfakngpt
    rwqykrtinqvvhrwgshtvpfllepdningktctasqlchntrchnplhlcweslddnk
    grnwcpgpnggcvhavvclrqgplygpgatvagpqqrgshfvv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2o6mB (B:)
    altnaqilavidsweetvgqfpvithhvplggglqgtlhcyeiplaapygvgfakngptr
    wqykrtinqvvhrwgshtvpfllepdningktctasqlchntrchnplhlcweslddnkg
    rnwcpgpnggcvhavvclrqgplygpgatvagpqqrgshfvv
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.