PDB entry 2o6k

View 2o6k on RCSB PDB site
Description: Crystal structure of UPF0346 from Staphylococcus aureus. Northeast Structural Genomics target ZR218.
Class: structural genomics, unknown function
Keywords: ZR218, NESG, Structural Genomics, PSI-2, Protein Structure Initiative, Northeast Structural Genomics Consortium, UNKNOWN FUNCTION
Deposited on 2006-12-07, released 2006-12-26
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: UPF0346 protein MW1311
    Species: Staphylococcus aureus [TaxId:196620]
    Gene: MW1311
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7BEF3 (Start-72)
      • modified residue (10)
      • modified residue (56)
      • expression tag (73-74)
    Domains in SCOPe 2.08: d2o6ka1, d2o6ka2
  • Chain 'B':
    Compound: UPF0346 protein MW1311
    Species: Staphylococcus aureus [TaxId:196620]
    Gene: MW1311
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7BEF3 (Start-72)
      • modified residue (10)
      • modified residue (56)
      • expression tag (73-76)
    Domains in SCOPe 2.08: d2o6kb2, d2o6kb3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2o6kA (A:)
mknysfyqfvmtvrgrhddkgrlaeeifddlafpkhdddfnilsdyiethgdftlpmsvf
ddlyeeytewlkflehhhhhh

    Sequence, based on observed residues (ATOM records): (download) 
    >2o6kA (A:)
ysfyqfvmtvrgrhddkgrlaeeifddlafpkhdddfnilsdyiethgdftlpmsvfddl
yeeytewlkfle

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >2o6kB (B:)
mknysfyqfvmtvrgrhddkgrlaeeifddlafpkhdddfnilsdyiethgdftlpmsvf
ddlyeeytewlkflehhhhhh

    Sequence, based on observed residues (ATOM records): (download) 
    >2o6kB (B:)
ysfyqfvmtvrgrhddkgrlaeeifddlafpkhdddfnilsdyiethgdftlpmsvfddl
yeeytewlkflehh