PDB entry 2o63

View 2o63 on RCSB PDB site
Description: Crystal structure of Pim1 with Myricetin
Class: transferase
Keywords: Pim1, Myricetin, TRANSFERASE
Deposited on 2006-12-06, released 2007-02-13
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.194
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Proto-oncogene serine/threonine-protein kinase Pim-1
    Species: Homo sapiens [TaxId:9606]
    Gene: PIM1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2o63a_
  • Heterogens: IMD, MYC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2o63A (A:)
    kekeplesqyqvgpllgsggfgsvysgirvsdnlpvaikhvekdrisdwgelpngtrvpm
    evvllkkvssgfsgvirlldwferpdsfvlilerpepvqdlfdfitergalqeelarsff
    wqvleavrhchncgvlhrdikdenilidlnrgelklidfgsgallkdtvytdfdgtrvys
    ppewiryhryhgrsaavwslgillydmvcgdipfehdeeiirgqvffrqrvssecqhlir
    wclalrpsdrptfeeiqnhpwmqdvllpqetaeihlhslspgpskvdhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2o63A (A:)
    plesqyqvgpllgsggfgsvysgirvsdnlpvaikhvekdrisdwgelpngtrvpmevvl
    lkkvssgfsgvirlldwferpdsfvlilerpepvqdlfdfitergalqeelarsffwqvl
    eavrhchncgvlhrdikdenilidlnrgelklidfgsgallkdtvytdfdgtrvysppew
    iryhryhgrsaavwslgillydmvcgdipfehdeeiirgqvffrqrvssecqhlirwcla
    lrpsdrptfeeiqnhpwmqdvllpqetaeihlhs