PDB entry 2o61

View 2o61 on RCSB PDB site
Description: Crystal Structure of NFkB, IRF7, IRF3 bound to the interferon-b enhancer
Class: transcription/DNA
Keywords: protein-DNA complex, transcription-DNA complex
Deposited on 2006-12-06, released 2007-07-24
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-12-07, with a file datestamp of 2011-12-02.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.245
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transcription factor p65/Interferon regulatory factor 7/Interferon regulatory factor 3 fusion protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q04206 (2-273)
      • cloning artifact (1)
      • engineered (399)
      • linker (407-413)
    • Uniprot Q92985 (289-406)
    • Uniprot Q14653 (428-530)
  • Chain 'B':
    Compound: Nuclear factor NF-kappa-B p105 subunit
    Species: Homo sapiens [TaxId:9606]
    Gene: NFKB1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P19838 (1-313)
      • initiating methionine (0)
    Domains in SCOPe 2.05: d2o61b1, d2o61b2
  • Chain 'E':
    Compound: 36-mer
  • Chain 'F':
    Compound: 34-mer
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2o61B (B:)
mdgpylqileqpkqrgfrfryvcegpshgglpgasseknkksypqvkicnyvgpakvivq
lvtngknihlhahslvgkhcedgictvtagpkdmvvgfanlgilhvtkkkvfetlearmt
eacirgynpgllvhpdlaylqaegggdrqlgdrekelirqaalqqtkemdlsvvrlmfta
flpdstgsftrrlepvvsdaiydskapnasnlkivrmdrtagcvtggeeiyllcdkvqkd
diqirfyeeeenggvwegfgdfsptdvhrqfaivfktpkykdinitkpasvfvqlrrksd
letsepkpflyype

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.