PDB entry 2o5u

View 2o5u on RCSB PDB site
Description: Crystal structure of the PA5185 protein from Pseudomonas Aeruginosa strain PAO1- orthorhombic form (C222).
Class: hydrolase
Keywords: putative thioesterese,, HYDROLASE
Deposited on 2006-12-06, released 2007-12-18
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.91 Å
R-factor: 0.192
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: thioesterase
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: PA5185
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HU04 (1-End)
      • expression tag (0)
    Domains in SCOPe 2.03: d2o5ua_
  • Chain 'B':
    Compound: thioesterase
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: PA5185
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2o5ub_
  • Chain 'C':
    Compound: thioesterase
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: PA5185
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2o5uc_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2o5uA (A:)
    amataprplreqylhfqpistrwhdndiyghvnnvtyyaffdtavntylierggldiqgg
    eviglvvssscdyfapvafpqriemglrvarlgnssvqyelalflegqreacaagrfvhv
    fverrssrpvaipqelrdalaalqssaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2o5uA (A:)
    amataprplreqylhfqpistrwhdndiyghvnnvtyyaffdtavntylierggldiqgg
    eviglvvssscdyfapvafpqriemglrvarlgnssvqyelalflegqreacaagrfvhv
    fverrssrpvaipqelrdalaalq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2o5uB (B:)
    amataprplreqylhfqpistrwhdndiyghvnnvtyyaffdtavntylierggldiqgg
    eviglvvssscdyfapvafpqriemglrvarlgnssvqyelalflegqreacaagrfvhv
    fverrssrpvaipqelrdalaalqssaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2o5uB (B:)
    prplreqylhfqpistrwhdndiyghvnnvtyyaffdtavntylierggldiqggevigl
    vvssscdyfapvafpqriemglrvarlgnssvqyelalflegqreacaagrfvhvfverr
    ssrpvaipqelrdalaalqssaq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2o5uC (C:)
    amataprplreqylhfqpistrwhdndiyghvnnvtyyaffdtavntylierggldiqgg
    eviglvvssscdyfapvafpqriemglrvarlgnssvqyelalflegqreacaagrfvhv
    fverrssrpvaipqelrdalaalqssaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2o5uC (C:)
    rplreqylhfqpistrwhdndiyghvnnvtyyaffdtavntylierggldiqggeviglv
    vssscdyfapvafpqriemglrvarlgnssvqyelalflegqreacaagrfvhvfverrs
    srpvaipqelrdalaalqss