SCOPe 2.05: Structural Classification of Proteins

PDB entry 2o5q

View 2o5q on RCSB PDB site
Description: Manganese horse heart myoglobin, nitric oxide modified
Class: oxygen storage/transport
Keywords: Manganese protoporphyrin IX, manganese myoglobin, nitric oxide, horse heart, OXYGEN STORAGE-TRANSPORT COMPLEX
Deposited on 2006-12-06, released 2007-10-16
The last revision prior to the SCOPe 2.05 freeze date was dated 2010-10-20, with a file datestamp of 2010-10-15.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.18
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

Chain 'X':
Compound: Myoglobin
Species: Equus caballus [TaxId:9796]
Database cross-references and differences (RAF-indexed):
- Uniprot P68082 (0-End)
Domains in SCOPe 2.05: d2o5qx_
Heterogens: SO4, MNH, NO, HOH

PDB Chain Sequences:

Chain 'X':
Sequence, based on SEQRES records: (download)

>2o5qX (X:)
glsdgewqqvlnvwgkveadiaghgqevlirlftghpetlekfdkfkhlkteaemkased
lkkhgtvvltalggilkkkghheaelkplaqshatkhkipikylefisdaiihvlhskhp
gdfgadaqgamtkalelfrndiaakykelgfqg

Sequence, based on observed residues (ATOM records): (download)

>2o5qX (X:)
glsdgewqqvlnvwgkveadiaghgqevlirlftghpetlekfdkfkhlkteaemkased
lkkhgtvvltalggilkkkghheaelkplaqshatkhkipikylefisdaiihvlhskhp
gdfgadaqgamtkalelfrndiaakykelgfq