PDB entry 2o5i

View 2o5i on RCSB PDB site
Description: Crystal structure of the T. thermophilus RNA polymerase elongation complex
Class: transferase/DNA-RNA hybrid
Keywords: RNA polymerase, elongation complex, template DNA, non-template DNA, RNA transcript, TRANSFERASE-DNA-RNA HYBRID COMPLEX
Deposited on 2006-12-06, released 2007-07-03
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.238
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA-directed RNA polymerase alpha chain
    Species: Thermus thermophilus [TaxId:300852]
    Gene:
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: DNA-directed RNA polymerase alpha chain
    Species: Thermus thermophilus [TaxId:300852]
    Gene:
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: DNA-directed RNA polymerase beta chain
    Species: Thermus thermophilus [TaxId:300852]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2o5ic_
  • Chain 'D':
    Compound: DNA-directed RNA polymerase beta' chain
    Species: Thermus thermophilus [TaxId:300852]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2o5id1
  • Chain 'E':
    Compound: DNA-directed RNA polymerase omega chain
    Species: Thermus thermophilus [TaxId:300852]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2o5ie_
  • Chain 'G':
    Compound: 5'-d(p*cp*cp*cp*tp*gp*tp*cp*tp*gp*gp*cp*gp*tp*tp*cp*gp*cp*gp*cp*gp*cp*cp*g)-3'
    Species:
    Gene:
  • Chain 'H':
    Compound: 5'-r(p*gp*ap*gp*up*cp*up*gp*cp*gp*gp*cp*gp*cp*gp*cp*g)-3'
    Species:
    Gene:
  • Chain 'I':
    Compound: 5'-d(*ap*ap*cp*gp*cp*cp*ap*gp*ap*cp*ap*gp*gp*g)-3'
    Species:
    Gene:
  • Chain 'K':
    Compound: DNA-directed RNA polymerase alpha chain
    Species: Thermus thermophilus [TaxId:300852]
    Gene:
    Database cross-references and differences (RAF-indexed):
  • Chain 'L':
    Compound: DNA-directed RNA polymerase alpha chain
    Species: Thermus thermophilus [TaxId:300852]
    Gene:
    Database cross-references and differences (RAF-indexed):
  • Chain 'M':
    Compound: DNA-directed RNA polymerase beta chain
    Species: Thermus thermophilus [TaxId:300852]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2o5im_
  • Chain 'N':
    Compound: DNA-directed RNA polymerase beta' chain
    Species: Thermus thermophilus [TaxId:300852]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2o5in1
  • Chain 'O':
    Compound: DNA-directed RNA polymerase omega chain
    Species: Thermus thermophilus [TaxId:300852]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2o5io_
  • Chain 'X':
    Compound: 5'-d(p*cp*cp*cp*tp*gp*tp*cp*tp*gp*gp*cp*gp*tp*tp*cp*gp*cp*gp*cp*gp*cp*cp*g)-3'
    Species:
    Gene:
  • Chain 'Y':
    Compound: 5'-r(p*gp*ap*gp*up*cp*up*gp*cp*gp*gp*cp*gp*cp*gp*cp*g)-3'
    Species:
    Gene:
  • Chain 'Z':
    Compound: 5'-d(*ap*ap*cp*gp*cp*cp*ap*gp*ap*cp*ap*gp*gp*g)-3'
    Species:
    Gene:
  • Heterogens: ZN, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2o5iC (C:)
    meikrfgrireviplpplteiqvesyrralqadvppekrenvgiqaafretfpieeedkg
    kgglvldfleyrlgeppfpqdecrekdltyqaplyarlqlihkdtglikedevflghipl
    mtedgsfiingadrvivsqihrspgvyftpdparpgryiasiiplpkrgpwidlevepng
    vvsmkvnkrkfplvlllrvlgydqetlarelgaygelvqglmdesvfamrpeealirlft
    llrpgdppkrdkavayvygliadprrydlgeagrykaeeklgirlsgrtlarfedgefkd
    evflptlrylfaltagvpghevddidhlgnrrirtvgelmtdqfrvglarlargvrerml
    mgsedsltpaklvnsrpleaaireffsrsqlsqfkdetnplsslrhkrrisalgpggltr
    eragfdvrdvhrthygricpvetpeganiglitslaayarvdelgfirtpyrrvvggvvt
    devvymtateedrytiaqantplegnriaaervvarrkgepvivspeevefmdvspkqvf
    svntnlipflehddanralmgsnmqtqavpliraqapvvmtgleervvrdslaalyaeed
    gevakvdgnrivvryedgrlveyplrrfyrsnqgtaldqrprvvvgqrvrkgdlladgpa
    sengflalgqnvlvaimpfdgynfedaiviseellkrdfytsihieryeieardtklgpe
    ritrdiphlseaalrdldeegvvrigaevkpgdilvgrtsfkgeseptpeerllrsifge
    kardvkdtslrvppgeggivvrtvrlrrgdpgvelkpgvrevvrvyvaqkrklqvgdkla
    nrhgnkgvvakilpvedmphlpdgtpvdvilnplgvpsrmnlgqilethlglagyflgqr
    yispifdgakepeikellaqafevyfgkrkgegfgvdkrevevlrraeklglvtpgktpe
    eqlkelflqgkvvlydgrtgepiegpivvgqmfimklyhmvedkmharstgpyslitqqp
    lggkaqfggqrfgemevwaleaygaahtlqemltlksddiegrnaayeaiikgedvpeps
    vpesfrvlvkelqalaldvqtldekdnpvdifeglaskr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2o5iD (D:)
    mkkevrkvrialaspekirswsygevekpetinyrtlkperdglfderifgpikdyecac
    gkykrqrfegkvcercgvevtksivrryrmghielatpaahiwfvkdvpskigtlldlsa
    teleqvlyfskyivldpkgailngvpvekrqlltdeeyrelrygkqetyplppgvdalvk
    dgeevvkgqelapgvvsrldgvalyrfprrvrveyvkkeraglrlplaawvekeaykpge
    ilaelpepylfraeeegvvelkeleegaflvlrredepvatyflpvgmtplvvhgeivek
    gqplaeakgllrmprqvraaqveaeeegetvyltlflewtepkdyrvqphmnvvvpegar
    veagdkivaaidpeeeviaeaegvvhlhepasilvvkarvypfeddvevstgdrvapgdv
    ladggkvksdvygrvevdlvrnvvrvvesydidarmgaeaiqqllkeldlealekellee
    mkhpsrarrakarkrlevvrafldsgnrpewmileavpvlppdlrpmvqvdggrfatsdl
    ndlyrrlinrnnrlkkllaqgapeiiirnekrmlqeavdalldngrrgapvtnpgsdrpl
    rsltdilsgkqgrfrqnllgkrvdysgrsvivvgpqlklhqcglpkrmalelfkpfllkk
    meekgiapnvkaarrmlerqrdikdevwdaleevihgkvvllnraptlhrlgiqafqpvl
    vegqsiqlhplvceafnadfdgdqmavhvplssfaqaeariqmlsahnllspasgeplak
    psrdiilglyyitqvrkekkgaglefatpeealaahergevalnapikvagretsvgrlk
    yvfanpdeallavahgivdlqdvvtvrymgkrletspgrilfarivaeavedekvaweli
    qldvpqeknslkdlvyqaflrlgmektarlldalkyygftfsttsgitigiddavipeek
    kqyleeadrkllqieqayemgfltdrerydqilqlwtettekvtqavfknfeenypfnpl
    yvmaqsgargnpqqirqlcglrglmqkpsgetfevpvrssfregltvleyfisshgarkg
    gadtalrtadsgyltrklvdvtheivvreadcgttnyisvplfqpdevtrslrlrkradi
    eaglygrvlarevevlgvrleegrylsmddvhllikaaeageiqevpvrspltcqtrygv
    cqkcygydlsmarpvsigeavgivaaqsigepgtqltmrtfhtggvagaaditqglprvi
    elfearrpkakaviseidgvvrieeteeklsvfvesegfskeyklpkearllvkdgdyve
    agqpltrgaidphqlleakgpeaverylveeiqkvyraqgvklhdkhieivvrqmmkyve
    vtdpgdsrllegqvlekwdvealnerliaegktpvawkpllmgvtksalstkswlsaasf
    qntthvlteaaiagkkdeliglkenvilgrlipagtgsdfvrftqvvdqktlkaieeark
    eaveakerpaarrgvkreqpgkqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2o5iD (D:)
    kkevrkvrialaspekirswsygevekpetinyrtlkperdglfderifgpikdyecacg
    kykrqrfegkvcercgvevtksivrryrmghielatpaahiwfvkdvpskigtlldlsat
    eleqvlyfskyivldpkgailngvpvekrqlltdeeyrelrygkqetyplppgvdalvkd
    geevvkgqelapgvvsrldgvalyrfasilvvkarvypfeddvevstgdrvapgdvladg
    gkvksdvygrvevdlvrnvvrvvesydidarmgaeaiqqllkeldlealekelleemkhp
    srarrakarkrlevvrafldsgnrpewmileavpvlppdlrpmvqvdggrfatsdlndly
    rrlinrnnrlkkllaqgapeiiirnekrmlqeavdalldngrrgapvtnpgsdrplrslt
    dilsgkqgrfrqnllgkrvdysgrsvivvgpqlklhqcglpkrmalelfkpfllkkmeek
    giapnvkaarrmlerqrdikdevwdaleevihgkvvllnraptlhrlgiqafqpvlvegq
    siqlhplvceafnadfdgdqmavhvplssfaqaeariqmlsahnllspasgeplakpsrd
    iilglyyitqvrkekkgaglefatpeealaahergevalnapikvagretsvgrlkyvfa
    npdeallavahgivdlqdvvtvrymgkrletspgrilfarivaeavedekvaweliqldv
    pqeknslkdlvyqaflrlgmektarlldalkyygftfsttsgitigiddavipeekkqyl
    eeadrkllqieqayemgfltdrerydqilqlwtettekvtqavfknfeenypfnplyvma
    qsgargnpqqirqlcglrglmqkpsgetfevpvrssfregltvleyfisshgarkggadt
    alrtadsgyltrklvdvtheivvreadcgttnyisvplfqpdevtrslrlrkradieagl
    ygrvlarevevlgvrleegrylsmddvhllikaaeageiqevpvrspltcqtrygvcqkc
    ygydlsmarpvsigeavgivaaqsigepgtqlglprvielfearrpkakaviseidgvvr
    ieeteeklsvfvesegfskeyklpkearllvkdgdyveagqpltrgaidphqlleakgpe
    averylveeiqkvyraqgvklhdkhieivvrqmmkyvevtdpgdsrllegqvlekwdvea
    lnerliaegktpvawkpllmgvtksalstkswlsaasfqntthvlteaaiagkkdeligl
    kenvilgrlipagtgsdfvrftqvvdqktlkaieearkeavea
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2o5iE (E:)
    maepgidklfgmvdskyrltvvvakraqqllrhgfkntvlepeerpkmqtleglfddpna
    vtwamkelltgrlvfgenlvpedrlqkemerlypveree
    

    Sequence, based on observed residues (ATOM records): (download)
    >2o5iE (E:)
    aepgidklfgmvdskyrltvvvakraqqllrhgfkntvlepeerpkmqtleglfddpnav
    twamkelltgrlvfgenlvpedrlqkemerlypve
    

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    No sequence available.

  • Chain 'K':
    No sequence available.

  • Chain 'L':
    No sequence available.

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2o5iM (M:)
    meikrfgrireviplpplteiqvesyrralqadvppekrenvgiqaafretfpieeedkg
    kgglvldfleyrlgeppfpqdecrekdltyqaplyarlqlihkdtglikedevflghipl
    mtedgsfiingadrvivsqihrspgvyftpdparpgryiasiiplpkrgpwidlevepng
    vvsmkvnkrkfplvlllrvlgydqetlarelgaygelvqglmdesvfamrpeealirlft
    llrpgdppkrdkavayvygliadprrydlgeagrykaeeklgirlsgrtlarfedgefkd
    evflptlrylfaltagvpghevddidhlgnrrirtvgelmtdqfrvglarlargvrerml
    mgsedsltpaklvnsrpleaaireffsrsqlsqfkdetnplsslrhkrrisalgpggltr
    eragfdvrdvhrthygricpvetpeganiglitslaayarvdelgfirtpyrrvvggvvt
    devvymtateedrytiaqantplegnriaaervvarrkgepvivspeevefmdvspkqvf
    svntnlipflehddanralmgsnmqtqavpliraqapvvmtgleervvrdslaalyaeed
    gevakvdgnrivvryedgrlveyplrrfyrsnqgtaldqrprvvvgqrvrkgdlladgpa
    sengflalgqnvlvaimpfdgynfedaiviseellkrdfytsihieryeieardtklgpe
    ritrdiphlseaalrdldeegvvrigaevkpgdilvgrtsfkgeseptpeerllrsifge
    kardvkdtslrvppgeggivvrtvrlrrgdpgvelkpgvrevvrvyvaqkrklqvgdkla
    nrhgnkgvvakilpvedmphlpdgtpvdvilnplgvpsrmnlgqilethlglagyflgqr
    yispifdgakepeikellaqafevyfgkrkgegfgvdkrevevlrraeklglvtpgktpe
    eqlkelflqgkvvlydgrtgepiegpivvgqmfimklyhmvedkmharstgpyslitqqp
    lggkaqfggqrfgemevwaleaygaahtlqemltlksddiegrnaayeaiikgedvpeps
    vpesfrvlvkelqalaldvqtldekdnpvdifeglaskr
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >2o5iN (N:)
    mkkevrkvrialaspekirswsygevekpetinyrtlkperdglfderifgpikdyecac
    gkykrqrfegkvcercgvevtksivrryrmghielatpaahiwfvkdvpskigtlldlsa
    teleqvlyfskyivldpkgailngvpvekrqlltdeeyrelrygkqetyplppgvdalvk
    dgeevvkgqelapgvvsrldgvalyrfprrvrveyvkkeraglrlplaawvekeaykpge
    ilaelpepylfraeeegvvelkeleegaflvlrredepvatyflpvgmtplvvhgeivek
    gqplaeakgllrmprqvraaqveaeeegetvyltlflewtepkdyrvqphmnvvvpegar
    veagdkivaaidpeeeviaeaegvvhlhepasilvvkarvypfeddvevstgdrvapgdv
    ladggkvksdvygrvevdlvrnvvrvvesydidarmgaeaiqqllkeldlealekellee
    mkhpsrarrakarkrlevvrafldsgnrpewmileavpvlppdlrpmvqvdggrfatsdl
    ndlyrrlinrnnrlkkllaqgapeiiirnekrmlqeavdalldngrrgapvtnpgsdrpl
    rsltdilsgkqgrfrqnllgkrvdysgrsvivvgpqlklhqcglpkrmalelfkpfllkk
    meekgiapnvkaarrmlerqrdikdevwdaleevihgkvvllnraptlhrlgiqafqpvl
    vegqsiqlhplvceafnadfdgdqmavhvplssfaqaeariqmlsahnllspasgeplak
    psrdiilglyyitqvrkekkgaglefatpeealaahergevalnapikvagretsvgrlk
    yvfanpdeallavahgivdlqdvvtvrymgkrletspgrilfarivaeavedekvaweli
    qldvpqeknslkdlvyqaflrlgmektarlldalkyygftfsttsgitigiddavipeek
    kqyleeadrkllqieqayemgfltdrerydqilqlwtettekvtqavfknfeenypfnpl
    yvmaqsgargnpqqirqlcglrglmqkpsgetfevpvrssfregltvleyfisshgarkg
    gadtalrtadsgyltrklvdvtheivvreadcgttnyisvplfqpdevtrslrlrkradi
    eaglygrvlarevevlgvrleegrylsmddvhllikaaeageiqevpvrspltcqtrygv
    cqkcygydlsmarpvsigeavgivaaqsigepgtqltmrtfhtggvagaaditqglprvi
    elfearrpkakaviseidgvvrieeteeklsvfvesegfskeyklpkearllvkdgdyve
    agqpltrgaidphqlleakgpeaverylveeiqkvyraqgvklhdkhieivvrqmmkyve
    vtdpgdsrllegqvlekwdvealnerliaegktpvawkpllmgvtksalstkswlsaasf
    qntthvlteaaiagkkdeliglkenvilgrlipagtgsdfvrftqvvdqktlkaieeark
    eaveakerpaarrgvkreqpgkqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2o5iN (N:)
    kkevrkvrialaspekirswsygevekpetinyrtlkperdglfderifgpikdyecacg
    kykrqrfegkvcercgvevtksivrryrmghielatpaahiwfvkdvpskigtlldlsat
    eleqvlyfskyivldpkgailngvpvekrqlltdeeyrelrygkqetyplppgvdalvkd
    geevvkgqelapgvvsrldgvalyrfasilvvkarvypfeddvevstgdrvapgdvladg
    gkvksdvygrvevdlvrnvvrvvesydidarmgaeaiqqllkeldlealekelleemkhp
    srarrakarkrlevvrafldsgnrpewmileavpvlppdlrpmvqvdggrfatsdlndly
    rrlinrnnrlkkllaqgapeiiirnekrmlqeavdalldngrrgapvtnpgsdrplrslt
    dilsgkqgrfrqnllgkrvdysgrsvivvgpqlklhqcglpkrmalelfkpfllkkmeek
    giapnvkaarrmlerqrdikdevwdaleevihgkvvllnraptlhrlgiqafqpvlvegq
    siqlhplvceafnadfdgdqmavhvplssfaqaeariqmlsahnllspasgeplakpsrd
    iilglyyitqvrkekkgaglefatpeealaahergevalnapikvagretsvgrlkyvfa
    npdeallavahgivdlqdvvtvrymgkrletspgrilfarivaeavedekvaweliqldv
    pqeknslkdlvyqaflrlgmektarlldalkyygftfsttsgitigiddavipeekkqyl
    eeadrkllqieqayemgfltdrerydqilqlwtettekvtqavfknfeenypfnplyvma
    qsgargnpqqirqlcglrglmqkpsgetfevpvrssfregltvleyfisshgarkggadt
    alrtadsgyltrklvdvtheivvreadcgttnyisvplfqpdevtrslrlrkradieagl
    ygrvlarevevlgvrleegrylsmddvhllikaaeageiqevpvrspltcqtrygvcqkc
    ygydlsmarpvsigeavgivaaqsigepgtqlglprvielfearrpkakaviseidgvvr
    ieeteeklsvfvesegfskeyklpkearllvkdgdyveagqpltrgaidphqlleakgpe
    averylveeiqkvyraqgvklhdkhieivvrqmmkyvevtdpgdsrllegqvlekwdvea
    lnerliaegktpvawkpllmgvtksalstkswlsaasfqntthvlteaaiagkkdeligl
    kenvilgrlipagtgsdfvrftqvvdqktlkaieearkeavea
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >2o5iO (O:)
    maepgidklfgmvdskyrltvvvakraqqllrhgfkntvlepeerpkmqtleglfddpna
    vtwamkelltgrlvfgenlvpedrlqkemerlypveree
    

    Sequence, based on observed residues (ATOM records): (download)
    >2o5iO (O:)
    aepgidklfgmvdskyrltvvvakraqqllrhgfkntvlepeerpkmqtleglfddpnav
    twamkelltgrlvfgenlvpedrlqkemerlypve
    

  • Chain 'X':
    No sequence available.

  • Chain 'Y':
    No sequence available.

  • Chain 'Z':
    No sequence available.