PDB entry 2o58

View 2o58 on RCSB PDB site
Description: Horse heart met manganese myoglobin
Class: oxygen storage/transport
Keywords: Horse heart, manganese myoglobin, oxidized form, manganese protoporphyrin IX, OXYGEN STORAGE-TRANSPORT COMPLEX
Deposited on 2006-12-05, released 2007-10-16
The last revision prior to the SCOPe 2.05 freeze date was dated 2010-10-20, with a file datestamp of 2010-10-15.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.181
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'X':
    Compound: Myoglobin
    Species: Equus caballus [TaxId:9796]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2o58x_
  • Heterogens: SO4, MNR, HOH

PDB Chain Sequences:

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >2o58X (X:)
    glsdgewqqvlnvwgkveadiaghgqevlirlftghpetlekfdkfkhlkteaemkased
    lkkhgtvvltalggilkkkghheaelkplaqshatkhkipikylefisdaiihvlhskhp
    gdfgadaqgamtkalelfrndiaakykelgfqg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2o58X (X:)
    glsdgewqqvlnvwgkveadiaghgqevlirlftghpetlekfdkfkhlkteaemkased
    lkkhgtvvltalggilkkkghheaelkplaqshatkhkipikylefisdaiihvlhskhp
    gdfgadaqgamtkalelfrndiaakykelgfq