PDB entry 2o50

View 2o50 on RCSB PDB site
Description: The crystal structure of Toxoplasma gondii Enoyl acyl carrier protein reductase
Class: oxidoreductase
Keywords: enoyl reductase, Rossmann fold, OXIDOREDUCTASE
Deposited on 2006-12-05, released 2006-12-26
The last revision prior to the SCOPe 2.02 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.213
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: enoyl-acyl carrier reductase
    Species: TOXOPLASMA GONDII [TaxId:383379]
    Gene: ENR
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6UCJ9
      • modified residue (167)
      • modified residue (192)
      • modified residue (294)
      • modified residue (303)
    Domains in SCOPe 2.02: d2o50a_
  • Chain 'B':
    Compound: enoyl-acyl carrier reductase
    Species: TOXOPLASMA GONDII [TaxId:383379]
    Gene: ENR
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6UCJ9
      • modified residue (167)
      • modified residue (192)
      • modified residue (294)
      • modified residue (303)
    Domains in SCOPe 2.02: d2o50b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2o50A (A:)
    safpidlrgqtafvagvadshgygwaiakhlasagarvalgtwppvlglfqkslqsgrld
    edrklpdgsliefagvypldaafdkpedvpqdikdnkryagvdgytikevavkvkqdlgn
    idilvhslangpevtkplletsrkgylaassnsaysfvsllqhfgpimneggsavtlsyl
    aaervvpgygggmssakaalesdtrtlaweagqkygvrvnaisagplksraasaigksge
    ksfidyaidysynnaplrrdlhsddvggaalfllsplaravsgvtlyvdnglhamgqavd
    srsmpplqratqein
    

    Sequence, based on observed residues (ATOM records): (download)
    >2o50A (A:)
    pidlrgqtafvagvadshgygwaiakhlasagarvalgtwppvlglfqkslqsgrldedr
    klpdgsliefagvypldaafdkpedvpqdikdnkryagvdgytikevavkvkqdlgnidi
    lvhslangpevtkplletsrkgylaassnsaysfvsllqhfgpimneggsavtlsylaae
    rvvpgygggmssakaalesdtrtlaweagqkygvrvnaisagplksfidyaidysynnap
    lrrdlhsddvggaalfllsplaravsgvtlyvdnglhamgqavdsrsmpp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2o50B (B:)
    safpidlrgqtafvagvadshgygwaiakhlasagarvalgtwppvlglfqkslqsgrld
    edrklpdgsliefagvypldaafdkpedvpqdikdnkryagvdgytikevavkvkqdlgn
    idilvhslangpevtkplletsrkgylaassnsaysfvsllqhfgpimneggsavtlsyl
    aaervvpgygggmssakaalesdtrtlaweagqkygvrvnaisagplksraasaigksge
    ksfidyaidysynnaplrrdlhsddvggaalfllsplaravsgvtlyvdnglhamgqavd
    srsmpplqratqein
    

    Sequence, based on observed residues (ATOM records): (download)
    >2o50B (B:)
    fpidlrgqtafvagvadshgygwaiakhlasagarvalgtwppvlglfqkslqsgrlded
    rklpdgsliefagvypldaafdkpedvpqdikdnkryagvdgytikevavkvkqdlgnid
    ilvhslangpevtkplletsrkgylaassnsaysfvsllqhfgpimneggsavtlsylaa
    ervvpgygggmssakaalesdtrtlaweagqkygvrvnaisagplsfidyaidysynnap
    lrrdlhsddvggaalfllsplaravsgvtlyvdnglhamgqavdsrsmpp