PDB entry 2o4x

View 2o4x on RCSB PDB site
Description: Crystal structure of human P100 tudor domain
Class: hydrolase
Keywords: OB fold, beta barrel, aromatic cage, HYDROLASE
Deposited on 2006-12-05, released 2007-02-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.234
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Staphylococcal nuclease domain-containing protein 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7KZF4 (0-216)
      • conflict (28)
  • Chain 'B':
    Compound: Staphylococcal nuclease domain-containing protein 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7KZF4 (0-90)
      • conflict (2)
    Domains in SCOPe 2.08: d2o4xb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2o4xB (B:)
    tqfeklmenmrndiashppvegsyaprrgefciakfvdgewyrarvekvespakihvfyi
    dygnrevlpstrlgtlspafstrvlpaqate
    

    Sequence, based on observed residues (ATOM records): (download)
    >2o4xB (B:)
    tqfeklmenmrndiashppyaprrgefciakfvdgewyrarvekvespakihvfyidygn
    revlpstrlgtlspafstrvlpaqate