PDB entry 2o4t

View 2o4t on RCSB PDB site
Description: CRYSTAL STRUCTURE OF a protein of the DUF1048 family with a left-handed superhelix fold (BH3976) FROM BACILLUS HALODURANS AT 1.95 A RESOLUTION
Class: unknown function
Keywords: left-handed superhelix fold, structural genomics, joint center for structural genomics, jcsg, protein structure initiative, psi-2, unknown function
Deposited on 2006-12-04, released 2006-12-26
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: BH3976 protein
  Species: Bacillus halodurans [TaxId:86665]
  Gene: 10176601
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9K5W1
  Domains in SCOPe 2.08: d2o4ta1
• Heterogens: PEG, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >2o4tA (A:)
  gahvsrveklpkdyqivykeiqkylfkvgpvelnegigllseilgffeegaaagkgvldv
  tgtdvaafcdaligdsktyadlyqesiqqhvdkamknmkd
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >2o4tA (A:)
  hvsrveklpkdyqivykeiqkylfkvgpvelnegigllseilgffeegaaagkgvldvtg
  tdvaafcdaligdsktyadlyqesiqqhvd