PDB entry 2o4m

View 2o4m on RCSB PDB site
Description: Structure of Phosphotriesterase mutant I106G/F132G/H257Y
Class: hydrolase
Keywords: metalloenzyme, tim barrel, nerve agents, hydrolase
Deposited on 2006-12-04, released 2007-12-18
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.64 Å
R-factor: 0.192
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Parathion hydrolase
    Species: Brevundimonas diminuta [TaxId:293]
    Gene: OPD
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A434 (0-End)
      • engineered (72)
      • engineered (98)
      • engineered (223)
    Domains in SCOPe 2.06: d2o4ma_
  • Chain 'B':
    Compound: Parathion hydrolase
    Species: Brevundimonas diminuta [TaxId:293]
    Gene: OPD
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A434 (0-330)
      • engineered (72)
      • engineered (98)
      • engineered (223)
    Domains in SCOPe 2.06: d2o4mb_
  • Chain 'C':
    Compound: Parathion hydrolase
    Species: Brevundimonas diminuta [TaxId:293]
    Gene: OPD
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A434 (0-330)
      • engineered (72)
      • engineered (98)
      • engineered (223)
    Domains in SCOPe 2.06: d2o4mc_
  • Chain 'P':
    Compound: Parathion hydrolase
    Species: Brevundimonas diminuta [TaxId:293]
    Gene: OPD
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A434 (0-330)
      • engineered (72)
      • engineered (98)
      • engineered (223)
    Domains in SCOPe 2.06: d2o4mp_
  • Heterogens: ZN, CAC, GOL, ACY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2o4mA (A:)
    gdrintvrgpitiseagftlthehicgssagflrawpeffgsrkalaekavrglrraraa
    gvrtivdvstfdggrdvsllaevsraadvhivaatglwgdpplsmrlrsveeltqfflre
    iqygiedtgiragiikvattgkatpfqelvlkaaaraslatgvpvtthtaasqrdgeqqa
    aifeseglspsrvcighsddtddlsyltalaargyligldhipysaiglednasasallg
    irswqtrallikalidqgymkqilvsndwlfgfssyvtnimdvmdrvnpdgmafiplrvi
    pflrekgvpqetlagitvtnparflsptlra
    

    Sequence, based on observed residues (ATOM records): (download)
    >2o4mA (A:)
    gdrintvrgpitiseagftlthehicgssagflrawpeffgsrkalaekavrglrraraa
    gvrtivdvstfdggrdvsllaevsraadvhivaatglwgdpplsmrlrsveeltqfflre
    iqygiedtgiragiikvattgkatpfqelvlkaaaraslatgvpvtthtaasqrdgeqqa
    aifeseglspsrvcighsddtddlsyltalaargyligldhipysaiglednasasallg
    irswqtrallikalidqgymkqilvsndwlfgfssyvtnimdvmdrvnpdgmafiplrvi
    pflrekgvpqetlagitvtnparflsptlr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2o4mB (B:)
    gdrintvrgpitiseagftlthehicgssagflrawpeffgsrkalaekavrglrraraa
    gvrtivdvstfdggrdvsllaevsraadvhivaatglwgdpplsmrlrsveeltqfflre
    iqygiedtgiragiikvattgkatpfqelvlkaaaraslatgvpvtthtaasqrdgeqqa
    aifeseglspsrvcighsddtddlsyltalaargyligldhipysaiglednasasallg
    irswqtrallikalidqgymkqilvsndwlfgfssyvtnimdvmdrvnpdgmafiplrvi
    pflrekgvpqetlagitvtnparflsptlra
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2o4mC (C:)
    gdrintvrgpitiseagftlthehicgssagflrawpeffgsrkalaekavrglrraraa
    gvrtivdvstfdggrdvsllaevsraadvhivaatglwgdpplsmrlrsveeltqfflre
    iqygiedtgiragiikvattgkatpfqelvlkaaaraslatgvpvtthtaasqrdgeqqa
    aifeseglspsrvcighsddtddlsyltalaargyligldhipysaiglednasasallg
    irswqtrallikalidqgymkqilvsndwlfgfssyvtnimdvmdrvnpdgmafiplrvi
    pflrekgvpqetlagitvtnparflsptlra
    

  • Chain 'P':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2o4mP (P:)
    gdrintvrgpitiseagftlthehicgssagflrawpeffgsrkalaekavrglrraraa
    gvrtivdvstfdggrdvsllaevsraadvhivaatglwgdpplsmrlrsveeltqfflre
    iqygiedtgiragiikvattgkatpfqelvlkaaaraslatgvpvtthtaasqrdgeqqa
    aifeseglspsrvcighsddtddlsyltalaargyligldhipysaiglednasasallg
    irswqtrallikalidqgymkqilvsndwlfgfssyvtnimdvmdrvnpdgmafiplrvi
    pflrekgvpqetlagitvtnparflsptlra