PDB entry 2o4l

View 2o4l on RCSB PDB site
Description: Crystal Structure of HIV-1 Protease (Q7K, I50V) in Complex with Tipranavir
Class: Viral Protein
Keywords: protease, Viral Protein
Deposited on 2006-12-04, released 2006-12-12
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.33 Å
R-factor: 0.193
AEROSPACI score: 0.71 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Protease
  Species: Human immunodeficiency virus 1 [TaxId:11676]
  Gene: gag-pol
  Database cross-references and differences (RAF-indexed):
  • Uniprot P03367 (0-98)
    • engineered (6)
    • engineered (49)
  Domains in SCOPe 2.04: d2o4la_
• Chain 'B':
  Compound: Protease
  Species: Human immunodeficiency virus 1 [TaxId:11676]
  Gene: gag-pol
  Database cross-references and differences (RAF-indexed):
  • Uniprot P03367 (0-98)
    • engineered (6)
    • engineered (49)
  Domains in SCOPe 2.04: d2o4lb_
• Heterogens: CL, TPV, GOL, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2o4lA (A:)
  pqitlwkrplvtikiggqlkealldtgaddtvleemslpgrwkpkmiggvggfikvrqyd
  qilieicghkaigtvlvgptpvniigrnlltqigctlnf
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2o4lB (B:)
  pqitlwkrplvtikiggqlkealldtgaddtvleemslpgrwkpkmiggvggfikvrqyd
  qilieicghkaigtvlvgptpvniigrnlltqigctlnf