PDB entry 2o4k

View 2o4k on RCSB PDB site
Description: Crystal Structure of HIV-1 Protease (Q7K) in Complex with Atazanavir
Class: Viral protein
Keywords: protease complex
Deposited on 2006-12-04, released 2006-12-12
The last revision prior to the SCOP 1.75 freeze date was dated 2007-08-21, with a file datestamp of 2007-08-17.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.186
AEROSPACI score: 0.72 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Gag-Pol polyprotein (Pr160Gag-Pol)
  Species: Human immunodeficiency virus type 1
  Gene: gag-pol
  Database cross-references and differences (RAF-indexed):
  • Uniprot P03367 (0-98)
    • engineered (6)
  Domains in SCOP 1.75: d2o4ka1
• Chain 'B':
  Compound: Gag-Pol polyprotein (Pr160Gag-Pol)
  Species: Human immunodeficiency virus type 1
  Gene: gag-pol
  Database cross-references and differences (RAF-indexed):
  • Uniprot P03367 (0-98)
    • engineered (6)
  Domains in SCOP 1.75: d2o4kb1
• Heterogens: CL, DR7, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2o4kA (A:)
  pqitlwkrplvtikiggqlkealldtgaddtvleemslpgrwkpkmiggiggfikvrqyd
  qilieicghkaigtvlvgptpvniigrnlltqigctlnf
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2o4kB (B:)
  pqitlwkrplvtikiggqlkealldtgaddtvleemslpgrwkpkmiggiggfikvrqyd
  qilieicghkaigtvlvgptpvniigrnlltqigctlnf