PDB entry 2o4j

View 2o4j on RCSB PDB site
Description: Crystal Structure of Rat Vitamin D Receptor Ligand Binding Domain Complexed with VitIII 17-20Z and the NR2 Box of DRIP 205
Class: hormone/growth factor receptor
Keywords: Nuclear receptor-ligand complex, HORMONE/GROWTH FACTOR RECEPTOR COMPLEX
Deposited on 2006-12-04, released 2007-01-30
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.74 Å
R-factor: 0.201
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Vitamin D3 receptor
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Vdr, Nr1i1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2o4ja1
  • Chain 'C':
    Compound: Peroxisome proliferator-activated receptor-binding protein
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Heterogens: VD4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2o4jA (A:)
    lkdslrpklseeqqhiiailldahhktydptyadfrdfrppvrmdgstgsvtldlsplsm
    lphladlvsysiqkvigfakmipgfrdltsddqivllkssaievimlrsnqsftmddmsw
    dcgsqdykydvtdvskaghtlelieplikfqvglkklnlheeehvllmaicivspdrpgv
    qdaklveaiqdrlsntlqtyircrhpppgshqlyakmiqkladlrslneehskqyrslsf
    qpensmkltplvlevfgneislvprgsmaisdpnsssvdklaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2o4jA (A:)
    klseeqqhiiailldahhktydptyadfrdfrppvrmplsmlphladlvsysiqkvigfa
    kmipgfrdltsddqivllkssaievimlrsnqsftmddmswdcgsqdykydvtdvskagh
    tlelieplikfqvglkklnlheeehvllmaicivspdrpgvqdaklveaiqdrlsntlqt
    yircrhpppgshqlyakmiqkladlrslneehskqyrslsfqpensmkltplvlevfgne
    

  • Chain 'C':
    No sequence available.