PDB entry 2o4i

View 2o4i on RCSB PDB site
Description: Structure of TREX1 in complex with DNA
Class: hydrolase/DNA
Keywords: TREX1, exonuclease, DnaQ, DNA complex, WW motif, protein-protein interaction, polyproline binding motif, HYDROLASE-DNA COMPLEX
Deposited on 2006-12-04, released 2007-03-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 3.5 Å
R-factor: 0.245
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Three prime repair exonuclease 1
    Species: Mus musculus [TaxId:10090]
    Gene: Trex1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q91XB0 (10-End)
      • engineered (196)
    Domains in SCOPe 2.08: d2o4ia1
  • Chain 'B':
    Compound: Three prime repair exonuclease 1
    Species: Mus musculus [TaxId:10090]
    Gene: Trex1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q91XB0 (10-End)
      • engineered (196)
    Domains in SCOPe 2.08: d2o4ib1
  • Chain 'C':
    Compound: 5'-d(*gp*cp*tp*ap*gp*gp*cp*ap*gp*gp*ap*ap*cp*cp*cp*cp*tp*cp*cp*tp*cp*cp*cp*cp*t)-3'
  • Chain 'D':
    Compound: 5'-d(*gp*cp*tp*ap*gp*gp*cp*ap*gp*gp*ap*ap*cp*cp*cp*cp*tp*cp*cp*tp*cp*cp*cp*cp*t)-3'

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2o4iA (A:)
    mkhhhhhhpmghmqtlifldleatglpssrpevtelcllavhrralentsisqghpppvp
    rpprvvdklslciapgkacspgaseitglskaelevqgrqrfddnlaillraflqrqpqp
    cclvahngdrydfpllqtelarlstpspldgtfcvdsiaalkaleqasspsgngsrksys
    lgsiytrlywqaptdsataegdvltllsicqwkpqallqwvdeharpfstvkpmygtpat
    tgttnlr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2o4iA (A:)
    ghmqtlifldleatglpssrpevtelcllavhrralentsisqghpppvprpprvvdkls
    lciapgkacspgaseitglskaelevqgrqrfddnlaillraflqrqpqpcclvahngdr
    ydfpllqtelarlstpspldgtfcvdsiaalkaleqasksyslgsiytrlywqaptdsat
    aegdvltllsicqwkpqallqwvdeharpfstvkpmyg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2o4iB (B:)
    mkhhhhhhpmghmqtlifldleatglpssrpevtelcllavhrralentsisqghpppvp
    rpprvvdklslciapgkacspgaseitglskaelevqgrqrfddnlaillraflqrqpqp
    cclvahngdrydfpllqtelarlstpspldgtfcvdsiaalkaleqasspsgngsrksys
    lgsiytrlywqaptdsataegdvltllsicqwkpqallqwvdeharpfstvkpmygtpat
    tgttnlr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2o4iB (B:)
    ghmqtlifldleatglpssrpevtelcllavhrralentsisqghpppvprpprvvdkls
    lciapgkacspgaseitglskaelevqgrqrfddnlaillraflqrqpqpcclvahngdr
    ydfpllqtelarlstpspldgtfcvdsiaalkaleqarksyslgsiytrlywqaptdsat
    aegdvltllsicqwkpqallqwvdeharpfstvkpmyg
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.