PDB entry 2o4e

View 2o4e on RCSB PDB site
Description: The solution structure of a protein-protein interaction module from a family 84 glycoside hydrolase of Clostridium perfringens
Class: protein binding
Keywords: beta-barrel, PROTEIN BINDING
Deposited on 2006-12-04, released 2007-11-06
The last revision prior to the SCOPe 2.03 freeze date was dated 2008-12-30, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: O-GlcNAcase nagJ
    Species: Clostridium perfringens [TaxId:1502]
    Gene: nagJ
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q0TR53 (23-164)
      • expression tag (0-22)
      • engineered (27)
    Domains in SCOPe 2.03: d2o4ea1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2o4eA (A:)
    mgsshhhhhhssglvprgshmasklkeaaevtgsvslealeevqvgenlevgvgidelvn
    aeafaydftlnydenafeyveaisddgvfvnakkiedgkvrvlvssltgeplpakevlak
    vvlraeakaegsnlsvtnssvgdgeglvheiagtektvniiegts