PDB entry 2o4d

View 2o4d on RCSB PDB site
Description: Crystal Structure of a hypothetical protein from Pseudomonas aeruginosa
Class: unknown function
Keywords: hypothetical protein, UNKNOWN FUNCTION
Deposited on 2006-12-04, released 2007-01-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical protein PA0269
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: PA0269
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9I6M1 (Start-164)
      • modified residue (37)
      • modified residue (73)
      • modified residue (159)
      • modified residue (161)
    Domains in SCOPe 2.08: d2o4da1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2o4dA (A:)
    mgsshhhhhhssglvprgshmttrlewakaspdayaamlglekalakaglerplielvyl
    rtsqingcaycvnmhandarkageteqrlqalcvwqetpyftpreraalawteqlarlsq
    galphglldelrehfddkeiaeltlavsainawnrfgvgmgmqpe
    

    Sequence, based on observed residues (ATOM records): (download)
    >2o4dA (A:)
    ttrlewakaspdayaamlglekalakaglerplielvylrtsqingcaycvnmhandark
    ageteqrlqalcvwqetpyftpreraalawteqlarlsqgalphglldelrehfddkeia
    eltlavsainawnrfgvgmgmqpe