PDB entry 2o49

View 2o49 on RCSB PDB site
Description: Crystal Structure of the N-terminal CUT domain of SATB1 Bound to Matrix Attachment Region DNA
Class: transcription/DNA
Keywords: protein-DNA complex, transcription, TRANSCRIPTION/DNA COMPLEX
Deposited on 2006-12-04, released 2007-08-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.212
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA-binding protein SATB1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q01826 (Start-88)
      • cloning artifact (89)
    Domains in SCOPe 2.07: d2o49a2, d2o49a3
  • Chain 'B':
    Compound: DNA (5'-d(*dgp*dcp*dtp*dap*dap*dtp*dap*dtp*dap*dtp*dgp*dc)-3')
  • Chain 'C':
    Compound: DNA (5'-d(*dgp*dcp*dap*dtp*dap*dtp*dap*dtp*dtp*dap*dgp*dc)-3')
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2o49A (A:)
    gshmntevsseiyqwvrdelkragisqavfarvafnrtqgllseilrkeedpktasqsll
    vnlramqnflqlpeaerdriyqdererslrkrk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2o49A (A:)
    evsseiyqwvrdelkragisqavfarvafnrtqgllseilrkeedpktasqsllvnlram
    qnflqlpeaerdriyqdererslr
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.