PDB entry 2o3h

View 2o3h on RCSB PDB site
Description: Crystal structure of the human C65A Ape
Class: lyase
Keywords: ape, endonuclease, lyase
Deposited on 2006-12-01, released 2007-12-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA-(apurinic or apyrimidinic site) lyase
    Species: Homo sapiens [TaxId:9606]
    Gene: APEX1, APE, APEX, APX, HAP1, REF1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P27695 (6-284)
      • expression tag (3-5)
      • engineered (31)
    Domains in SCOPe 2.07: d2o3ha1, d2o3ha2
  • Heterogens: SM, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2o3hA (A:)
    gshmasegpalyedppdqktspsgkpatlkiaswnvdglrawikkkgldwvkeeapdilc
    lqetkcsenklpaelqelpglshqywsapsdkegysgvgllsrqcplkvsygigdeehdq
    egrvivaefdsfvlvtayvpnagrglvrleyrqrwdeafrkflkglasrkplvlcgdlnv
    aheeidlrnpkgnkknagftpqerqgfgellqavpladsfrhlypntpyaytfwtymmna
    rsknvgwrldyfllshsllpalcdskirskalgsdhcpitlylal
    

    Sequence, based on observed residues (ATOM records): (download)
    >2o3hA (A:)
    masegpalyedppdqktspsgkpatlkiaswnvdglrawikkkgldwvkeeapdilclqe
    tkcsenklpaelqelpglshqywsapsegysgvgllsrqcplkvsygigdeehdqegrvi
    vaefdsfvlvtayvpnagrglvrleyrqrwdeafrkflkglasrkplvlcgdlnvaheei
    dlrnpkgnkknagftpqerqgfgellqavpladsfrhlypntpyaytfwtymmnarsknv
    gwrldyfllshsllpalcdskirskalgsdhcpitlylal