PDB entry 2o37

View 2o37 on RCSB PDB site
Description: J-domain of Sis1 protein, Hsp40 co-chaperone from Saccharomyces cerevisiae.
Class: chaperone
Keywords: hsp40, J-domain, cochaperone, APC90055.5, Structural Genomics, PSI-2, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, CHAPERONE
Deposited on 2006-11-30, released 2007-01-02
The last revision prior to the SCOPe 2.08 freeze date was dated 2014-12-17, with a file datestamp of 2014-12-12.
Experiment type: XRAY
Resolution: 1.25 Å
R-factor: 0.141
AEROSPACI score: 0.74 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein SIS1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: SIS1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2o37a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2o37A (A:)
snamvketklydllgvspsaneqelkkgyrkaalkyhpdkptgdtekfkeiseafeilnd
pqkreiydqygleaarsggpsfgpggpggagg

    Sequence, based on observed residues (ATOM records): (download) 
    >2o37A (A:)
mvketklydllgvspsaneqelkkgyrkaalkyhpdkptgdtekfkeiseafeilndpqk
reiydqygleaarsggpsfgp