PDB entry 2o36

View 2o36 on RCSB PDB site
Description: Crystal structure of engineered thimet oligopeptidase with neurolysin specificity in neurotensin cleavage site
Class: hydrolase
Keywords: thermolysin-like domain, substrate-binding channel, HYDROLASE
Deposited on 2006-11-30, released 2007-01-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thimet oligopeptidase
    Species: Homo sapiens [TaxId:9606]
    Gene: THOP1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P52888
      • engineered (230)
      • engineered (237)
      • engineered (453)
      • engineered (482)
    Domains in SCOPe 2.07: d2o36a_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2o36A (A:)
    spcsvvndlrwdlsaqqieertrelieqtkrvydqvgtqefedvsyestlkaladvevty
    tvqrnildfpqhvspskdirtasteadkklsefdvemsmredvyqrivwlqekvqkdslr
    peaarylerliklgrrnglhlpretqenikrikkklsllcidfnknlnedttflpftlqe
    lgglpedflnslekmedgklkvtlkyphyfpllkkchvpetrrkveeafnsrckeensai
    lkelvtlraqksrllgfhthadyvlemnmaktsqtvatfldelaqklkplgeqeravile
    lkraecerrglpfdgrirawdmryymnqveetrycvdqnllkeyfpvqvvthgllgiyqe
    llglafhheegasawhedvrlytardaasgevvgkfyldlypregkyghaacfglqpgcl
    rqdgsrqiaiaamvanftkptadapsllqhdevrtyfhefghvmhqlcsqaefamfsgth
    vetdfveapsqmlenwvweqepllrmsrhyrtgsavprellekliesrqantglfnlrqi
    vlakvdqalhtqtdadpaeeyarlcqeilgvpatpgtnmpatfghlaggydaqyygylws
    evysmdmfhtrfkqegvlnskvgmdyrscilrpggsedasamlrrflgrdpkqdafllsk
    glqvggcepepqvc
    

    Sequence, based on observed residues (ATOM records): (download)
    >2o36A (A:)
    lrwdlsaqqieertrelieqtkrvydqvgtqefedvsyestlkaladvevtytvqrnild
    fpqhvspskdirtasteadkklsefdvemsmredvyqrivwlqekvqkdslrpeaaryle
    rliklgrrnglhlpretqenikrikkklsllcidfnknlnedttflpftlqelgglpedf
    lnslekmedgklkvtlkyphyfpllkkchvpetrrkveeafnsrckeensailkelvtlr
    aqksrllgfhthadyvlemnmaktsqtvatfldelaqklkplgeqeravilelkraecer
    rglpfdgrirawdmryymnqveetrycvdqnllkeyfpvqvvthgllgiyqellglafhh
    eegasawhedvrlytardaasgevvgkfyldlypregkyghaacfglqpgclrqdgsrqi
    aiaamvanftkptadapsllqhdevrtyfhefghvmhqlcsqaefamfsgthvetdfvea
    psqmlenwvweqepllrmsrhyrtgsavprellekliesrqantglfnlrqivlakvdqa
    lhtqtdadpaeeyarlcqeilgvpatpgtnmpatfghlaggydaqyygylwsevysmdmf
    htrfkqegvlnskvgmdyrscilrpggsedasamlrrflgrdpkqdafllskgl