PDB entry 2o31

View 2o31 on RCSB PDB site
Description: Crystal structure of the second SH3 domain from ponsin
Class: signaling protein
Keywords: SH3, PONSIN, Src Homology 3, SIGNALING PROTEIN
Deposited on 2006-11-30, released 2007-10-23
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.132
AEROSPACI score: 0.69 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Ponsin
  Species: Homo sapiens [TaxId:9606]
  Gene: SORBS1
  Database cross-references and differences (RAF-indexed):
  • Uniprot A0AED4 (6-66)
    • expression tag (0-5)
  Domains in SCOPe 2.01: d2o31a_
• Heterogens: FMT, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2o31A (A:)
  gidpftgeaiakfnfngdtqvemsfrkgeritllrqvdenwyegripgtsrqgifpityv
  dvikrpl