PDB entry 2o31

View 2o31 on RCSB PDB site
Description: Crystal structure of the second SH3 domain from ponsin
Class: signaling protein
Keywords: SH3, PONSIN, Src Homology 3, SIGNALING PROTEIN
Deposited on 2006-11-30, released 2007-10-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.132
AEROSPACI score: 0.69 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ponsin
    Species: Homo sapiens [TaxId:9606]
    Gene: SORBS1
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0AED4 (6-66)
      • expression tag (0-5)
    Domains in SCOPe 2.07: d2o31a1, d2o31a2
  • Heterogens: FMT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2o31A (A:)
    gidpftgeaiakfnfngdtqvemsfrkgeritllrqvdenwyegripgtsrqgifpityv
    dvikrpl