PDB entry 2o2y

View 2o2y on RCSB PDB site
Description: The crystal structure of P. falciparum enoyl acyl carrier protein reductase
Class: oxidoreductase
Keywords: enoyl reductase, Rossmann fold, triclosan binding, OXIDOREDUCTASE
Deposited on 2006-11-30, released 2006-12-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.202
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: enoyl-acyl carrier reductase
    Species: PLASMODIUM FALCIPARUM [TaxId:36329]
    Gene: FabI
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2o2ya_
  • Chain 'B':
    Compound: enoyl-acyl carrier reductase
    Species: PLASMODIUM FALCIPARUM [TaxId:36329]
    Gene: FabI
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2o2yb_
  • Chain 'C':
    Compound: enoyl-acyl carrier reductase
    Species: PLASMODIUM FALCIPARUM [TaxId:36329]
    Gene: FabI
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2o2yc_
  • Chain 'D':
    Compound: enoyl-acyl carrier reductase
    Species: PLASMODIUM FALCIPARUM [TaxId:36329]
    Gene: FabI
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2o2yd_
  • Heterogens: CL, SO4, NAD, TCL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2o2yA (A:)
    asniykikeenknedicfiagigdtngygwgiakelskrnvkiifgiwppvynifmknyk
    ngkfdndmiidkdkkmnildmlpfdasfdtandideetknnkrynmlqnytiedvanlih
    qkygkinmlvhslanakevqkdllntsrkgyldalskssyslislckyfvnimkpqssii
    sltyhasqkvvpgygggmssakaalesdtrvlayhlgrnynirintisagplksraatai
    nklnntyenntnqnknrnshdvhnimnnsgekeekknsasqnytfidyaieysekyaplr
    qkllstdigsvasfllsresraitgqtiyvdnglnimflpddiyrnene
    

    Sequence, based on observed residues (ATOM records): (download)
    >2o2yA (A:)
    dicfiagigdtngygwgiakelskrnvkiifgiwppvynifmknykngkfdndmiidkdk
    kmnildmlpfdasfdtandideetknnkrynmlqnytiedvanlihqkygkinmlvhsla
    nakevqkdllntsrkgyldalskssyslislckyfvnimkpqssiisltyhasqkvvpgy
    gggmssakaalesdtrvlayhlgrnynirintisagplksraatainytfidyaieysek
    yaplrqkllstdigsvasfllsresraitgqtiyvdnglnimflpddiyr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2o2yB (B:)
    asniykikeenknedicfiagigdtngygwgiakelskrnvkiifgiwppvynifmknyk
    ngkfdndmiidkdkkmnildmlpfdasfdtandideetknnkrynmlqnytiedvanlih
    qkygkinmlvhslanakevqkdllntsrkgyldalskssyslislckyfvnimkpqssii
    sltyhasqkvvpgygggmssakaalesdtrvlayhlgrnynirintisagplksraatai
    nklnntyenntnqnknrnshdvhnimnnsgekeekknsasqnytfidyaieysekyaplr
    qkllstdigsvasfllsresraitgqtiyvdnglnimflpddiyrnene
    

    Sequence, based on observed residues (ATOM records): (download)
    >2o2yB (B:)
    dicfiagigdtngygwgiakelskrnvkiifgiwppvynifmknykngkfdndmiidkdk
    kmnildmlpfdasfdtandideetknnkrynmlqnytiedvanlihqkygkinmlvhsla
    nakevqkdllntsrkgyldalskssyslislckyfvnimkpqssiisltyhasqkvvpgy
    gggmssakaalesdtrvlayhlgrnynirintisagplksraatainytfidyaieysek
    yaplrqkllstdigsvasfllsresraitgqtiyvdnglnimflpddiyr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2o2yC (C:)
    asniykikeenknedicfiagigdtngygwgiakelskrnvkiifgiwppvynifmknyk
    ngkfdndmiidkdkkmnildmlpfdasfdtandideetknnkrynmlqnytiedvanlih
    qkygkinmlvhslanakevqkdllntsrkgyldalskssyslislckyfvnimkpqssii
    sltyhasqkvvpgygggmssakaalesdtrvlayhlgrnynirintisagplksraatai
    nklnntyenntnqnknrnshdvhnimnnsgekeekknsasqnytfidyaieysekyaplr
    qkllstdigsvasfllsresraitgqtiyvdnglnimflpddiyrnene
    

    Sequence, based on observed residues (ATOM records): (download)
    >2o2yC (C:)
    nedicfiagigdtngygwgiakelskrnvkiifgiwppvynifmknykngkfdndmiidk
    dkkmnildmlpfdasfdtandideetknnkrynmlqnytiedvanlihqkygkinmlvhs
    lanakevqkdllntsrkgyldalskssyslislckyfvnimkpqssiisltyhasqkvvp
    gygggmssakaalesdtrvlayhlgrnynirintisagplksraatainytfidyaieys
    ekyaplrqkllstdigsvasfllsresraitgqtiyvdnglnimflpddiyrn
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2o2yD (D:)
    asniykikeenknedicfiagigdtngygwgiakelskrnvkiifgiwppvynifmknyk
    ngkfdndmiidkdkkmnildmlpfdasfdtandideetknnkrynmlqnytiedvanlih
    qkygkinmlvhslanakevqkdllntsrkgyldalskssyslislckyfvnimkpqssii
    sltyhasqkvvpgygggmssakaalesdtrvlayhlgrnynirintisagplksraatai
    nklnntyenntnqnknrnshdvhnimnnsgekeekknsasqnytfidyaieysekyaplr
    qkllstdigsvasfllsresraitgqtiyvdnglnimflpddiyrnene
    

    Sequence, based on observed residues (ATOM records): (download)
    >2o2yD (D:)
    dicfiagigdtngygwgiakelskrnvkiifgiwppvynifmknykngkfdndmiidkdk
    kmnildmlpfdasfdtandideetknnkrynmlqnytiedvanlihqkygkinmlvhsla
    nakevqkdllntsrkgyldalskssyslislckyfvnimkpqssiisltyhasqkvvpgy
    gggmssakaalesdtrvlayhlgrnynirintisagplksraataiytfidyaieyseky
    aplrqkllstdigsvasfllsresraitgqtiyvdnglnimflpddiy