PDB entry 2o2w

View 2o2w on RCSB PDB site
Description: Extending powder diffraction to proteins: structure solution of the second SH3 domain from ponsin
Class: signaling protein
Keywords: powder diffraction, SH3, ponsin, SIGNALING PROTEIN
Deposited on 2006-11-30, released 2007-10-23
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-12.
Experiment type: PDIF
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ponsin
    Species: Homo sapiens [TaxId:9606]
    Gene: SORBS1
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0AED4 (6-66)
      • expression tag (0-5)
    Domains in SCOPe 2.06: d2o2wa1, d2o2wa2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2o2wA (A:)
    gidpftgeaiakfnfngdtqvemsfrkgeritllrqvdenwyegripgtsrqgifpityv
    dvikrpl