PDB entry 2o2w

View 2o2w on RCSB PDB site
Description: Extending powder diffraction to proteins: structure solution of the second SH3 domain from ponsin
Class: signaling protein
Keywords: powder diffraction, SH3, ponsin, SIGNALING PROTEIN
Deposited on 2006-11-30, released 2007-10-23
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-12.
Experiment type: PDIF
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.24 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Ponsin
  Species: Homo sapiens [TaxId:9606]
  Gene: SORBS1
  Database cross-references and differences (RAF-indexed):
  • Uniprot A0AED4 (6-66)
    • expression tag (0-5)
  Domains in SCOPe 2.04: d2o2wa_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2o2wA (A:)
  gidpftgeaiakfnfngdtqvemsfrkgeritllrqvdenwyegripgtsrqgifpityv
  dvikrpl