PDB entry 2o2v

View 2o2v on RCSB PDB site
Description: Crystal Structure of the Complex of Human Mitogen Activated Protein Kinase Kinase 5 Phox Domain (MAP2K5-phox) with Human Mitogen Activated Protein Kinase Kinase Kinase 3 (MAP3K3B-phox)
Class: transferase
Keywords: mitogen activated protein kinase kinase 5, MAP2K5, MEK5, MKK5, PRKMK5, MAP kinase 5, phox, phox-domain, mitogen activated protein kinase kinase kinase 3, MEKK3, MAPKKK3, MAP/ERK kinase kinase 3, Structural Genomics, Structural Genomics Consortium, SGC, TRANSFERASE
Deposited on 2006-11-30, released 2006-12-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 1.83 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Dual specificity mitogen-activated protein kinase kinase 5
    Species: Homo sapiens [TaxId:9606]
    Gene: MAP2K5, MEK5, MKK5, PRKMK5
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2o2va_
  • Chain 'B':
    Compound: Mitogen-activated protein kinase kinase kinase 3
    Species: Homo sapiens [TaxId:9606]
    Gene: MAP3K3, MAPKKK3, MEKK3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2o2vb1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2o2vA (A:)
    smalgpfpamenqvlvirikipnsgavdwtvhsgpqllfrdvldvigqvlpeatttafey
    ededgdritvrsdeemkamlsyyystvmeqqvngqlieplqifpra
    

    Sequence, based on observed residues (ATOM records): (download)
    >2o2vA (A:)
    vlvirikipnsgavdwtvhspqllfrdvldvigqvlpeatttafeyededgdritvrsde
    emkamlsyyystvmeqqvngqlieplqifpra
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2o2vB (B:)
    smghsnrqsdvrikfehngerriiafsrpvkyedvehkvttvfgqpldlhymnnelsill
    knqddldkaidildrsssmkslrilllsqd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2o2vB (B:)
    qsdvrikfehngerriiafsrpvkyedvehkvttvfgqpldlhymnnelsillknqddld
    kaidildrsssmkslrilllsq