PDB entry 2o2s

View 2o2s on RCSB PDB site
Description: The structure of T. gondii enoyl acyl carrier protein reductase in complex with NAD and triclosan
Class: oxidoreductase
Keywords: enoyl reductase, triclosan, Rossmann fold, OXIDOREDUCTASE
Deposited on 2006-11-30, released 2006-12-26
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.208
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: enoyl-acyl carrier reductase
    Species: TOXOPLASMA GONDII [TaxId:383379]
    Gene: ENR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2o2sa_
  • Chain 'B':
    Compound: enoyl-acyl carrier reductase
    Species: TOXOPLASMA GONDII [TaxId:383379]
    Gene: ENR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2o2sb_
  • Heterogens: NAD, TCL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2o2sA (A:)
    safpidlrgqtafvagvadshgygwaiakhlasagarvalgtwppvlglfqkslqsgrld
    edrklpdgsliefagvypldaafdkpedvpqdikdnkryagvdgytikevavkvkqdlgn
    idilvhslangpevtkplletsrkgylaassnsaysfvsllqhfgpimneggsavtlsyl
    aaervvpgygggmssakaalesdtrtlaweagqkygvrvnaisagplksraasaigksge
    ksfidyaidysynnaplrrdlhsddvggaalfllsplaravsgvtlyvdnglhamgqavd
    srsmpplqratqein
    

    Sequence, based on observed residues (ATOM records): (download)
    >2o2sA (A:)
    pidlrgqtafvagvadshgygwaiakhlasagarvalgtwppvlglfqkslqsgrldedr
    klpdgsliefagvypldaafdkpedvpqdikdnkryagvdgytikevavkvkqdlgnidi
    lvhslangpevtkplletsrkgylaassnsaysfvsllqhfgpimneggsavtlsylaae
    rvvpgygggmssakaalesdtrtlaweagqkygvrvnaisagplksraasaigksgeksf
    idyaidysynnaplrrdlhsddvggaalfllsplaravsgvtlyvdnglhamgqavdsrs
    mpp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2o2sB (B:)
    safpidlrgqtafvagvadshgygwaiakhlasagarvalgtwppvlglfqkslqsgrld
    edrklpdgsliefagvypldaafdkpedvpqdikdnkryagvdgytikevavkvkqdlgn
    idilvhslangpevtkplletsrkgylaassnsaysfvsllqhfgpimneggsavtlsyl
    aaervvpgygggmssakaalesdtrtlaweagqkygvrvnaisagplksraasaigksge
    ksfidyaidysynnaplrrdlhsddvggaalfllsplaravsgvtlyvdnglhamgqavd
    srsmpplqratqein
    

    Sequence, based on observed residues (ATOM records): (download)
    >2o2sB (B:)
    fpidlrgqtafvagvadshgygwaiakhlasagarvalgtwppvlglfqkslqsgrlded
    rklpdgsliefagvypldaafdkpedvpqdikdnkryagvdgytikevavkvkqdlgnid
    ilvhslangpevtkplletsrkgylaassnsaysfvsllqhfgpimneggsavtlsylaa
    ervvpgygggmssakaalesdtrtlaweagqkygvrvnaisagplksraasaigkeksfi
    dyaidysynnaplrrdlhsddvggaalfllsplaravsgvtlyvdnglhamgqavdsrsm
    pp