PDB entry 2o2o

View 2o2o on RCSB PDB site
Description: Solution structure of domain B from human CIN85 PROTEIN
Class: protein binding
Keywords: sh3, cin85, protein binding
Deposited on 2006-11-30, released 2007-11-13
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: SH3-domain kinase-binding protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: SH3KBP1, CIN85
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2o2oa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2o2oA (A:)
    smtggqqmgtnkrgerrrrrcqvafsylpqnddelelkvgdiievvgeveegwwegvlng
    ktgmfpsnfikelsgesdelgisqdehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2o2oA (A:)
    tnkrgerrrrrcqvafsylpqnddelelkvgdiievvgeveegwwegvlngktgmfpsnf
    ikelsgesdelgisq